BLASTX nr result
ID: Cheilocostus21_contig00021085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00021085 (634 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399015.1| PREDICTED: peroxisomal membrane protein 13 [... 75 1e-12 ref|XP_008775485.1| PREDICTED: peroxisomal membrane protein 13-l... 60 5e-07 >ref|XP_009399015.1| PREDICTED: peroxisomal membrane protein 13 [Musa acuminata subsp. malaccensis] Length = 278 Score = 75.1 bits (183), Expect = 1e-12 Identities = 38/53 (71%), Positives = 43/53 (81%), Gaps = 3/53 (5%) Frame = +2 Query: 2 RILGIRTRPKIQQQLAPGGPGELTAPAGQRYLEGPK---GSWDGVWGDDVKGS 151 RILGIRTR + QQQL GPGEL APAGQ+YLEGPK G+WD VWG+DV+GS Sbjct: 228 RILGIRTRSRKQQQL---GPGELPAPAGQQYLEGPKAPSGAWDSVWGNDVRGS 277 >ref|XP_008775485.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera] Length = 283 Score = 59.7 bits (143), Expect = 5e-07 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = +2 Query: 2 RILGIRTRPKIQQQLAPGGPGELTAPAGQRYLEGPK---GSWDGVWGDDVKGSS 154 R+LGI+TR + QLAPG L GQ+Y+EGPK GSWD VWGDDV+G+S Sbjct: 231 RLLGIKTRTRKHPQLAPGTLPGLDGN-GQQYIEGPKATTGSWDNVWGDDVRGAS 283