BLASTX nr result
ID: Cheilocostus21_contig00020757
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00020757 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412986.1| PREDICTED: uncharacterized protein LOC103994... 55 1e-05 >ref|XP_009412986.1| PREDICTED: uncharacterized protein LOC103994386 [Musa acuminata subsp. malaccensis] ref|XP_009412993.1| PREDICTED: uncharacterized protein LOC103994386 [Musa acuminata subsp. malaccensis] Length = 1016 Score = 55.5 bits (132), Expect = 1e-05 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = +1 Query: 1 WMEDQTKTGAETSGST---KRKEPDSGWEPSLFGHKKMTSGQ 117 WME+Q KTGA+ S S KRKEPDSGWEP G+K+MTS Q Sbjct: 975 WMEEQPKTGAQPSSSDTTLKRKEPDSGWEPYPHGYKQMTSWQ 1016