BLASTX nr result
ID: Cheilocostus21_contig00020270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00020270 (1276 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246545.1| ribosome biogenesis regulatory protein homol... 104 3e-21 ref|XP_009408968.1| PREDICTED: ribosome biogenesis regulatory pr... 101 3e-20 ref|XP_008792054.1| PREDICTED: ribosome biogenesis regulatory pr... 99 2e-19 ref|XP_009408971.1| PREDICTED: ribosome biogenesis regulatory pr... 99 2e-19 ref|XP_020680407.1| ribosome biogenesis regulatory protein homol... 98 4e-19 ref|XP_020089351.1| ribosome biogenesis regulatory protein homol... 97 1e-18 ref|XP_010056918.1| PREDICTED: ribosome biogenesis regulatory pr... 96 2e-18 gb|KMZ63973.1| Ribosome biogenesis regulatory protein-like prote... 95 6e-18 gb|PKI79561.1| hypothetical protein CRG98_000036 [Punica granatum] 95 7e-18 ref|XP_010250068.1| PREDICTED: ribosome biogenesis regulatory pr... 95 8e-18 ref|XP_018839554.1| PREDICTED: ribosome biogenesis regulatory pr... 93 3e-17 ref|XP_010914878.1| PREDICTED: ribosome biogenesis regulatory pr... 93 3e-17 ref|XP_002264648.1| PREDICTED: ribosome biogenesis regulatory pr... 93 3e-17 ref|XP_020586854.1| ribosome biogenesis regulatory protein homol... 92 4e-17 gb|PON88975.1| Ribosomal biogenesis regulatory protein [Trema or... 92 4e-17 ref|XP_022144805.1| ribosome biogenesis regulatory protein homol... 91 1e-16 gb|KJB54050.1| hypothetical protein B456_009G018400 [Gossypium r... 89 2e-16 ref|XP_021817768.1| ribosome biogenesis regulatory protein homol... 91 2e-16 ref|XP_020423883.1| ribosome biogenesis regulatory protein homol... 91 2e-16 ref|XP_006450951.1| ribosome biogenesis regulatory protein homol... 91 2e-16 >ref|XP_020246545.1| ribosome biogenesis regulatory protein homolog [Asparagus officinalis] gb|ONK80349.1| uncharacterized protein A4U43_C01F16700 [Asparagus officinalis] Length = 341 Score = 104 bits (260), Expect = 3e-21 Identities = 49/59 (83%), Positives = 53/59 (89%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HFQSIPS REELT+ CL+K TELVQA+AN LFSLPSTED DGP+VRLP PTTKLPREKH Sbjct: 21 HFQSIPSSREELTKECLQKGTELVQAIANALFSLPSTEDPDGPLVRLPQPTTKLPREKH 79 >ref|XP_009408968.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Musa acuminata subsp. malaccensis] Length = 315 Score = 101 bits (251), Expect = 3e-20 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF+S+PS R+ELTRACLEK TELVQA+AN +F+LPST+D DGPIVRLP PTT LPREKH Sbjct: 14 HFESVPSSRQELTRACLEKGTELVQAIANAVFALPSTDDPDGPIVRLPPPTTALPREKH 72 >ref|XP_008792054.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Phoenix dactylifera] Length = 322 Score = 99.4 bits (246), Expect = 2e-19 Identities = 46/59 (77%), Positives = 51/59 (86%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HFQSIPS RE+L + CL+K TELVQA+AN LFSLPSTED DGPIV LP PTT+LPREKH Sbjct: 21 HFQSIPSAREDLVKECLQKGTELVQAIANALFSLPSTEDPDGPIVHLPQPTTRLPREKH 79 >ref|XP_009408971.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Musa acuminata subsp. malaccensis] Length = 315 Score = 99.0 bits (245), Expect = 2e-19 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF+S+PS R+ELTRACLE TELVQA+AN +F+LPST+D DGPIVRLP PTT LPREKH Sbjct: 14 HFESVPSSRQELTRACLETGTELVQAIANAVFALPSTDDPDGPIVRLPPPTTTLPREKH 72 >ref|XP_020680407.1| ribosome biogenesis regulatory protein homolog [Dendrobium catenatum] ref|XP_020680408.1| ribosome biogenesis regulatory protein homolog [Dendrobium catenatum] Length = 322 Score = 98.2 bits (243), Expect = 4e-19 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HFQ +PS REEL+R CLEK TELVQ V N LFSLPSTED DGPIVRLP P+T+LPREKH Sbjct: 21 HFQPLPSSREELSRQCLEKGTELVQGVVNALFSLPSTEDLDGPIVRLPEPSTRLPREKH 79 >ref|XP_020089351.1| ribosome biogenesis regulatory protein homolog [Ananas comosus] Length = 332 Score = 97.1 bits (240), Expect = 1e-18 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF SIPS REEL CL+K TELVQ +AN LFSLPSTED DGPI++LP PTTKLPREKH Sbjct: 24 HFDSIPSSREELIMVCLQKGTELVQEIANALFSLPSTEDPDGPIIKLPPPTTKLPREKH 82 >ref|XP_010056918.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Eucalyptus grandis] gb|KCW73826.1| hypothetical protein EUGRSUZ_E02428 [Eucalyptus grandis] Length = 333 Score = 96.3 bits (238), Expect = 2e-18 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF S+PS REEL CLEK TELVQAVA+ LF+LPSTED DGPIV+LP PTTKLPREKH Sbjct: 22 HFPSLPSSREELIEKCLEKGTELVQAVADALFNLPSTEDVDGPIVKLPPPTTKLPREKH 80 >gb|KMZ63973.1| Ribosome biogenesis regulatory protein-like protein [Zostera marina] Length = 324 Score = 94.7 bits (234), Expect = 6e-18 Identities = 43/59 (72%), Positives = 50/59 (84%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF+S PS REELT+ CL K TELVQA+AN LFSLPS EDRDGP+++LP P+T LPREKH Sbjct: 23 HFESAPSSREELTQECLNKGTELVQAIANELFSLPSHEDRDGPLIKLPDPSTALPREKH 81 >gb|PKI79561.1| hypothetical protein CRG98_000036 [Punica granatum] Length = 329 Score = 94.7 bits (234), Expect = 7e-18 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = +2 Query: 5 FQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 F S+PS REEL +CL+K ELVQAVAN LFSLPSTED DGPIV+LP PTTKLPREKH Sbjct: 18 FSSLPSSREELVESCLQKGRELVQAVANALFSLPSTEDLDGPIVKLPPPTTKLPREKH 75 >ref|XP_010250068.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Nelumbo nucifera] Length = 336 Score = 94.7 bits (234), Expect = 8e-18 Identities = 43/59 (72%), Positives = 51/59 (86%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF S+PS R EL + CL+K TELVQA+A+ LF+LPSTEDRDGPIV+LP PTT+LPREKH Sbjct: 26 HFPSVPSERGELVKECLQKGTELVQAIADVLFNLPSTEDRDGPIVQLPPPTTRLPREKH 84 >ref|XP_018839554.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Juglans regia] Length = 340 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = +2 Query: 5 FQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREK 175 F S+PS REEL + CLEK TELVQA+ANTLF+LPSTED DGP+V+LP PTT+LPREK Sbjct: 22 FSSLPSSREELVKECLEKGTELVQAIANTLFNLPSTEDVDGPLVKLPPPTTRLPREK 78 >ref|XP_010914878.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Elaeis guineensis] Length = 322 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/59 (71%), Positives = 48/59 (81%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF S+PS RE+L + CL K TELVQ +AN LFSLPSTED DGPIV LP P+T+LPREKH Sbjct: 21 HFPSVPSAREDLVKECLHKGTELVQEIANALFSLPSTEDSDGPIVHLPQPSTRLPREKH 79 >ref|XP_002264648.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Vitis vinifera] emb|CBI38699.3| unnamed protein product, partial [Vitis vinifera] Length = 327 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/59 (71%), Positives = 51/59 (86%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF S PS REEL + CL+K TELVQ++A+TLF+LPSTED DGP+V+LP PTT+LPREKH Sbjct: 21 HFPSPPSSREELVKECLQKGTELVQSIADTLFNLPSTEDIDGPLVKLPPPTTRLPREKH 79 >ref|XP_020586854.1| ribosome biogenesis regulatory protein homolog [Phalaenopsis equestris] ref|XP_020586862.1| ribosome biogenesis regulatory protein homolog [Phalaenopsis equestris] Length = 321 Score = 92.4 bits (228), Expect = 4e-17 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HFQ +PS REEL R CLEK TELVQ + N LFSLP++E+ DGPIV+LP PTT+LPREKH Sbjct: 21 HFQPLPSSREELERQCLEKGTELVQEIVNVLFSLPASEELDGPIVQLPKPTTRLPREKH 79 >gb|PON88975.1| Ribosomal biogenesis regulatory protein [Trema orientalis] Length = 330 Score = 92.4 bits (228), Expect = 4e-17 Identities = 41/59 (69%), Positives = 51/59 (86%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF S+PS REEL + CL++ TELVQA+A+TLF+LPSTED DGP+V+LP P T+LPREKH Sbjct: 25 HFPSLPSSREELVKECLKRGTELVQAIADTLFNLPSTEDVDGPLVKLPPPVTRLPREKH 83 >ref|XP_022144805.1| ribosome biogenesis regulatory protein homolog [Momordica charantia] Length = 328 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/59 (72%), Positives = 47/59 (79%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 H S PS REEL CL+K TELVQA+AN LF LPSTEDRDGP+VRLP P T+LPREKH Sbjct: 22 HLTSPPSSREELVNECLQKGTELVQAIANELFILPSTEDRDGPLVRLPPPKTRLPREKH 80 >gb|KJB54050.1| hypothetical protein B456_009G018400 [Gossypium raimondii] Length = 248 Score = 89.0 bits (219), Expect = 2e-16 Identities = 37/59 (62%), Positives = 53/59 (89%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 +F S+P+ R+EL + C+++ T+LVQA+A+++F+LPSTED DGP+V+LPTPTTKLPREKH Sbjct: 26 NFPSLPTSRDELVKECIQEGTKLVQAIADSIFNLPSTEDADGPLVKLPTPTTKLPREKH 84 >ref|XP_021817768.1| ribosome biogenesis regulatory protein homolog [Prunus avium] Length = 328 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF SIPS REEL + CL K TELVQ++A+ LF+LPSTED DGP+V+LP P TKLPREKH Sbjct: 22 HFPSIPSSREELVKECLTKGTELVQSIADKLFNLPSTEDIDGPLVQLPRPETKLPREKH 80 >ref|XP_020423883.1| ribosome biogenesis regulatory protein homolog [Prunus persica] gb|ONH98293.1| hypothetical protein PRUPE_7G241100 [Prunus persica] Length = 328 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF SIPS REEL + CL K TELVQ++A+ LF+LPSTED DGP+V+LP P TKLPREKH Sbjct: 22 HFPSIPSSREELVKECLTKGTELVQSIADKLFNLPSTEDIDGPLVQLPRPETKLPREKH 80 >ref|XP_006450951.1| ribosome biogenesis regulatory protein homolog [Citrus clementina] ref|XP_006475826.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Citrus sinensis] gb|ESR64191.1| hypothetical protein CICLE_v10008881mg [Citrus clementina] gb|KDO80278.1| hypothetical protein CISIN_1g019971mg [Citrus sinensis] dbj|GAY50604.1| hypothetical protein CUMW_127950 [Citrus unshiu] Length = 333 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +2 Query: 2 HFQSIPSFREELTRACLEKATELVQAVANTLFSLPSTEDRDGPIVRLPTPTTKLPREKH 178 HF S+PS REEL + CLE+ T+LVQA+A+ LF+LPSTED DGPIV LP PTTKLPR KH Sbjct: 22 HFPSLPSSREELVKECLEEGTKLVQAIADRLFNLPSTEDVDGPIVTLPPPTTKLPRSKH 80