BLASTX nr result
ID: Cheilocostus21_contig00019435
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00019435 (633 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073491038.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_073421194.1| hypothetical protein [Enterococcus faecium] 53 4e-06 >ref|WP_073491038.1| hypothetical protein [Enterococcus faecium] Length = 62 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = +3 Query: 537 LFQMGISRSTGRSEERRVGKECRSRWSPYH 626 LFQ G S RSEERRVGKECRSRWSPYH Sbjct: 33 LFQYGQKLSAARSEERRVGKECRSRWSPYH 62 >ref|WP_073421194.1| hypothetical protein [Enterococcus faecium] Length = 73 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = +3 Query: 537 LFQMGISRSTGRSEERRVGKECRSRWSPYH 626 LF MG S RSEERRVGKECRSRWSPYH Sbjct: 44 LFVMGTSGKKTRSEERRVGKECRSRWSPYH 73