BLASTX nr result
ID: Cheilocostus21_contig00019434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00019434 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009398388.1| PREDICTED: thioredoxin H1-like [Musa acumina... 104 8e-28 ref|XP_010932739.1| PREDICTED: thioredoxin H1 [Elaeis guineensis] 98 6e-25 gb|PKU65485.1| Thioredoxin H1 [Dendrobium catenatum] 99 1e-22 gb|OAY74795.1| Thioredoxin H1 [Ananas comosus] 97 3e-22 ref|XP_020091655.1| thioredoxin H1-like [Ananas comosus] 97 3e-22 ref|XP_020697631.1| thioredoxin H1-like [Dendrobium catenatum] 97 3e-22 gb|OMO75250.1| Thioredoxin [Corchorus olitorius] 97 3e-22 ref|XP_020095590.1| thioredoxin H1-like [Ananas comosus] >gi|103... 96 5e-22 ref|XP_020590107.1| thioredoxin H1 [Phalaenopsis equestris] 93 5e-22 ref|XP_008796609.1| PREDICTED: thioredoxin H1-like [Phoenix dact... 90 5e-22 gb|PKU63496.1| Thioredoxin H1 [Dendrobium catenatum] 92 7e-22 ref|XP_020677622.1| thioredoxin H1-like [Dendrobium catenatum] 92 7e-22 gb|PKA46943.1| Thioredoxin H-type 2 [Apostasia shenzhenica] 91 3e-21 ref|XP_010254672.1| PREDICTED: thioredoxin H-type-like [Nelumbo ... 94 4e-21 gb|KJB14467.1| hypothetical protein B456_002G126200 [Gossypium r... 92 6e-21 ref|XP_010275525.1| PREDICTED: thioredoxin H-type-like [Nelumbo ... 93 6e-21 gb|PPD76375.1| hypothetical protein GOBAR_DD26695 [Gossypium bar... 93 7e-21 ref|XP_012466262.1| PREDICTED: thioredoxin H1-like [Gossypium ra... 92 1e-20 ref|XP_007046793.1| PREDICTED: thioredoxin H-type [Theobroma cac... 91 4e-20 gb|OVA08711.1| Thioredoxin [Macleaya cordata] 91 5e-20 >ref|XP_009398388.1| PREDICTED: thioredoxin H1-like [Musa acuminata subsp. malaccensis] Length = 114 Score = 104 bits (259), Expect(2) = 8e-28 Identities = 46/59 (77%), Positives = 52/59 (88%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEGA+IGCH+VDEW Q L QANES+KLV+IDFT SWCGPCR +APIF DLA +YPNV Sbjct: 1 MAEEGAVIGCHSVDEWKQHLLQANESKKLVVIDFTASWCGPCRAIAPIFADLAKRYPNV 59 Score = 47.8 bits (112), Expect(2) = 8e-28 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELHIPK 276 EGTI+D+IVGA KD LPRRIELH+PK Sbjct: 89 EGTIVDKIVGAHKDELPRRIELHMPK 114 >ref|XP_010932739.1| PREDICTED: thioredoxin H1 [Elaeis guineensis] Length = 114 Score = 98.2 bits (243), Expect(2) = 6e-25 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEGA+I CHTVDEW Q LQQ NES+KLV+IDFT SWC PCR +APIF +LA K+P V Sbjct: 1 MAEEGAVIACHTVDEWTQQLQQGNESKKLVVIDFTASWCAPCRMIAPIFAELARKFPGV 59 Score = 44.3 bits (103), Expect(2) = 6e-25 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELHIPK 276 EGTI+D++VGA KD LP++IELH+PK Sbjct: 89 EGTIVDKLVGAHKDDLPKKIELHMPK 114 >gb|PKU65485.1| Thioredoxin H1 [Dendrobium catenatum] Length = 150 Score = 98.6 bits (244), Expect = 1e-22 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -3 Query: 538 EMAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPN 362 EMAEEGA+IGCHTVDEWN L QA ES KLV++DFT SWCGPCR +APIF +LA K+ N Sbjct: 35 EMAEEGAVIGCHTVDEWNHQLGQAKESSKLVVVDFTASWCGPCRIIAPIFAELAKKFTN 93 >gb|OAY74795.1| Thioredoxin H1 [Ananas comosus] Length = 112 Score = 96.7 bits (239), Expect = 3e-22 Identities = 40/59 (67%), Positives = 50/59 (84%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEGA+I CH V+EW++ LQQANES+KLV++DFT SWCGPCR +AP+F + A KYP V Sbjct: 1 MAEEGAVIACHAVEEWSRQLQQANESKKLVVVDFTASWCGPCRMIAPVFAEFAKKYPGV 59 >ref|XP_020091655.1| thioredoxin H1-like [Ananas comosus] Length = 114 Score = 96.7 bits (239), Expect = 3e-22 Identities = 40/59 (67%), Positives = 50/59 (84%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEGA+I CH V+EW++ LQQANES+KLV++DFT SWCGPCR +AP+F + A KYP V Sbjct: 1 MAEEGAVIACHAVEEWSRQLQQANESKKLVVVDFTASWCGPCRMIAPVFAEFAKKYPGV 59 >ref|XP_020697631.1| thioredoxin H1-like [Dendrobium catenatum] Length = 115 Score = 96.7 bits (239), Expect = 3e-22 Identities = 42/58 (72%), Positives = 48/58 (82%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPN 362 MAEEGA+IGCHTVDEWN L QA ES KLV++DFT SWCGPCR +APIF +LA K+ N Sbjct: 1 MAEEGAVIGCHTVDEWNHQLGQAKESSKLVVVDFTASWCGPCRIIAPIFAELAKKFTN 58 >gb|OMO75250.1| Thioredoxin [Corchorus olitorius] Length = 122 Score = 96.7 bits (239), Expect = 3e-22 Identities = 41/59 (69%), Positives = 50/59 (84%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +IGCHTVD WN+ LQ+ANES+KLV++DFT SWCGPCR +API D+A K P+V Sbjct: 1 MAEEGLVIGCHTVDHWNEQLQKANESKKLVVVDFTASWCGPCRFIAPILADMAKKLPHV 59 >ref|XP_020095590.1| thioredoxin H1-like [Ananas comosus] gb|OAY82511.1| Thioredoxin H1 [Ananas comosus] Length = 114 Score = 95.9 bits (237), Expect = 5e-22 Identities = 40/59 (67%), Positives = 50/59 (84%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEGA+IGCH+VD+W Q L+ ANES+KLV++DFT SWC PCR +AP+F + A KYPNV Sbjct: 1 MAEEGAVIGCHSVDQWTQQLEIANESKKLVVVDFTASWCPPCRMIAPVFAEFAKKYPNV 59 >ref|XP_020590107.1| thioredoxin H1 [Phalaenopsis equestris] Length = 115 Score = 92.8 bits (229), Expect(2) = 5e-22 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +IGCH+VD+WN+ L+ A E++KL ++DFT SWCGPCRT+APIF +LA K+P V Sbjct: 1 MAEEGTVIGCHSVDQWNKHLELAIETKKLAVVDFTASWCGPCRTIAPIFTELAKKFPEV 59 Score = 39.7 bits (91), Expect(2) = 5e-22 Identities = 16/23 (69%), Positives = 21/23 (91%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELH 285 +GTI+D+IVGA KD LP++IELH Sbjct: 89 DGTIIDKIVGANKDELPKKIELH 111 >ref|XP_008796609.1| PREDICTED: thioredoxin H1-like [Phoenix dactylifera] Length = 114 Score = 90.1 bits (222), Expect(2) = 5e-22 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAE G++IGCHTVDEWNQ LQ+A ES+KLV+IDF SWCG CR +APIF +L+ K+ +V Sbjct: 1 MAEGGSVIGCHTVDEWNQQLQEARESKKLVVIDFPASWCGTCRMIAPIFAELSKKFTSV 59 Score = 42.4 bits (98), Expect(2) = 5e-22 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELHIPK 276 EGTI+D++VGA KD LP+RIEL +PK Sbjct: 89 EGTIVDKLVGAHKDDLPKRIELRMPK 114 >gb|PKU63496.1| Thioredoxin H1 [Dendrobium catenatum] Length = 115 Score = 92.4 bits (228), Expect(2) = 7e-22 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEE +I CH+V++WNQ LQ A E++KL ++DFT +WCGPCRT+APIF DLA K+PNV Sbjct: 1 MAEEATVISCHSVEQWNQHLQSAIETKKLAVVDFTATWCGPCRTIAPIFADLAKKFPNV 59 Score = 39.7 bits (91), Expect(2) = 7e-22 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELHIPK 276 +GTI+D+IVGA KD LP++IELH K Sbjct: 89 DGTIIDKIVGANKDDLPKKIELHSNK 114 >ref|XP_020677622.1| thioredoxin H1-like [Dendrobium catenatum] Length = 147 Score = 92.4 bits (228), Expect(2) = 7e-22 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEE +I CH+V++WNQ LQ A E++KL ++DFT +WCGPCRT+APIF DLA K+PNV Sbjct: 33 MAEEATVISCHSVEQWNQHLQSAIETKKLAVVDFTATWCGPCRTIAPIFADLAKKFPNV 91 Score = 39.7 bits (91), Expect(2) = 7e-22 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELHIPK 276 +GTI+D+IVGA KD LP++IELH K Sbjct: 121 DGTIIDKIVGANKDDLPKKIELHSNK 146 >gb|PKA46943.1| Thioredoxin H-type 2 [Apostasia shenzhenica] Length = 114 Score = 90.5 bits (223), Expect(2) = 3e-21 Identities = 37/59 (62%), Positives = 50/59 (84%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +IGCH+V++W+Q LQ A +++KL ++DFT SWCGPCR +APIF +LA K+PNV Sbjct: 1 MAEEGVVIGCHSVEQWDQHLQLAIQTKKLAVVDFTASWCGPCRMIAPIFAELAKKFPNV 59 Score = 39.7 bits (91), Expect(2) = 3e-21 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 353 EGTILDRIVGAQKDALPRRIELHIPK 276 EGTI+D+IVGA KD LP++I LH+ K Sbjct: 89 EGTIVDKIVGANKDDLPKKIGLHLSK 114 >ref|XP_010254672.1| PREDICTED: thioredoxin H-type-like [Nelumbo nucifera] Length = 114 Score = 93.6 bits (231), Expect = 4e-21 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +I CHTV+ WN+ LQ+ NES+KLV++DFT SWCGPCR MAPI +LA K PNV Sbjct: 1 MAEEGQVISCHTVEAWNEQLQKGNESKKLVVVDFTASWCGPCRFMAPILAELAKKLPNV 59 >gb|KJB14467.1| hypothetical protein B456_002G126200 [Gossypium raimondii] Length = 88 Score = 92.4 bits (228), Expect = 6e-21 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +I CHTVD WNQ L+ N+S+KLV++DFT SWCGPCR ++PI DLA K PNV Sbjct: 1 MAEEGQVIACHTVDSWNQQLEMGNQSKKLVVVDFTASWCGPCRFISPILVDLAKKLPNV 59 >ref|XP_010275525.1| PREDICTED: thioredoxin H-type-like [Nelumbo nucifera] Length = 115 Score = 93.2 bits (230), Expect = 6e-21 Identities = 39/59 (66%), Positives = 48/59 (81%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +IGCH+V+ WN+ LQ+ NES+KLV++DFT SWCGPCR M PI +LA K PNV Sbjct: 1 MAEEGQVIGCHSVEAWNEQLQKGNESKKLVVVDFTASWCGPCRLMTPILAELAKKLPNV 59 >gb|PPD76375.1| hypothetical protein GOBAR_DD26695 [Gossypium barbadense] Length = 119 Score = 93.2 bits (230), Expect = 7e-21 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +I CHTVD WNQ L+ NES KLV++DFT SWCGPCR ++PI DLA K PNV Sbjct: 1 MAEEGQVIACHTVDSWNQQLEMGNESNKLVVVDFTASWCGPCRFISPILVDLAKKLPNV 59 >ref|XP_012466262.1| PREDICTED: thioredoxin H1-like [Gossypium raimondii] ref|XP_016742028.1| PREDICTED: thioredoxin H1-like [Gossypium hirsutum] gb|KJB14466.1| hypothetical protein B456_002G126200 [Gossypium raimondii] Length = 119 Score = 92.4 bits (228), Expect = 1e-20 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +I CHTVD WNQ L+ N+S+KLV++DFT SWCGPCR ++PI DLA K PNV Sbjct: 1 MAEEGQVIACHTVDSWNQQLEMGNQSKKLVVVDFTASWCGPCRFISPILVDLAKKLPNV 59 >ref|XP_007046793.1| PREDICTED: thioredoxin H-type [Theobroma cacao] gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 91.3 bits (225), Expect = 4e-20 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = -3 Query: 532 AEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 AEEG +IGCHTV+ WN+ LQ+ NES+KLV++DFT SWCGPCR +AP +LA K PNV Sbjct: 3 AEEGQVIGCHTVESWNEQLQKGNESKKLVVVDFTASWCGPCRFIAPFLAELAKKLPNV 60 >gb|OVA08711.1| Thioredoxin [Macleaya cordata] Length = 113 Score = 90.9 bits (224), Expect = 5e-20 Identities = 36/59 (61%), Positives = 48/59 (81%) Frame = -3 Query: 535 MAEEGALIGCHTVDEWNQVLQQANESQKLVIIDFTTSWCGPCRTMAPIFDDLAGKYPNV 359 MAEEG +IGCH+V+ W + LQ+ NES+KL+++DFT SWCGPCR +API ++A K PNV Sbjct: 1 MAEEGQVIGCHSVEAWKEQLQKGNESKKLIVVDFTASWCGPCRVIAPILSEIAKKLPNV 59