BLASTX nr result
ID: Cheilocostus21_contig00018751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00018751 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413170.1| PREDICTED: uncharacterized protein At1g04910... 59 5e-07 >ref|XP_009413170.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 591 Score = 58.5 bits (140), Expect = 5e-07 Identities = 34/64 (53%), Positives = 39/64 (60%) Frame = +2 Query: 278 FHSLLTSSALFDPSAAASAWPGRRPHSTKPSSILLKNLMELQRNAVGPVDVFHVPSAGGH 457 FHSLL S L + SA A P R + KPSSILLK ++LQRNA G VD F VPS G Sbjct: 36 FHSLLAPSPLLNGSAPDMAGPARHRRA-KPSSILLKKPVDLQRNAAGAVDAFRVPSGRGS 94 Query: 458 SESD 469 +D Sbjct: 95 PVTD 98