BLASTX nr result
ID: Cheilocostus21_contig00018587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00018587 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009387561.1| PREDICTED: transcription factor Pur-alpha 1-... 91 9e-19 ref|XP_010938121.1| PREDICTED: transcription factor Pur-alpha 1 ... 89 2e-18 ref|XP_010938120.1| PREDICTED: transcription factor Pur-alpha 1 ... 89 2e-18 emb|CBI16575.3| unnamed protein product, partial [Vitis vinifera] 89 3e-18 gb|KJB53641.1| hypothetical protein B456_009G000700, partial [Go... 86 4e-18 ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1 ... 89 5e-18 ref|XP_008793346.1| PREDICTED: transcription factor Pur-alpha 1-... 89 5e-18 emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] 89 6e-18 gb|ONM31143.1| Transcription factor Pur-alpha 1 [Zea mays] 86 6e-18 gb|PNX86412.1| transcription factor Pur-alpha 1, partial [Trifol... 82 6e-18 ref|XP_020241302.1| transcription factor Pur-alpha 1-like [Aspar... 88 7e-18 gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] 88 9e-18 gb|PON37210.1| Purine-rich element binding protein family [Paras... 88 9e-18 ref|XP_019705954.1| PREDICTED: transcription factor Pur-alpha 1-... 88 9e-18 ref|XP_010921295.1| PREDICTED: transcription factor Pur-alpha 1-... 88 9e-18 ref|XP_015883613.1| PREDICTED: transcription factor Pur-alpha 1 ... 88 1e-17 ref|XP_024020357.1| transcription factor Pur-alpha 1 [Morus nota... 88 1e-17 gb|PON45957.1| Purine-rich element binding protein family [Trema... 88 1e-17 gb|OVA12965.1| PUR-alpha/beta/gamma [Macleaya cordata] 88 1e-17 gb|PPR92653.1| hypothetical protein GOBAR_AA28013 [Gossypium bar... 86 1e-17 >ref|XP_009387561.1| PREDICTED: transcription factor Pur-alpha 1-like [Musa acuminata subsp. malaccensis] Length = 281 Score = 90.5 bits (223), Expect = 9e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEMIGHFVEITKDR++GM GANVRTLEPAQR Sbjct: 236 DRSSIILPLSGLKQFHEMIGHFVEITKDRLEGMVGANVRTLEPAQR 281 >ref|XP_010938121.1| PREDICTED: transcription factor Pur-alpha 1 isoform X2 [Elaeis guineensis] Length = 280 Score = 89.4 bits (220), Expect = 2e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEMIGHFVEITKDR++GMTG NVRT+EPAQR Sbjct: 235 DRSSIILPLSGLKQFHEMIGHFVEITKDRLEGMTGPNVRTVEPAQR 280 >ref|XP_010938120.1| PREDICTED: transcription factor Pur-alpha 1 isoform X1 [Elaeis guineensis] Length = 281 Score = 89.4 bits (220), Expect = 2e-18 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEMIGHFVEITKDR++GMTG NVRT+EPAQR Sbjct: 236 DRSSIILPLSGLKQFHEMIGHFVEITKDRLEGMTGPNVRTVEPAQR 281 >emb|CBI16575.3| unnamed protein product, partial [Vitis vinifera] Length = 256 Score = 88.6 bits (218), Expect = 3e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEM+GHFVEITKDRI+GMTGANVRT++P QR Sbjct: 211 DRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 256 >gb|KJB53641.1| hypothetical protein B456_009G000700, partial [Gossypium raimondii] Length = 144 Score = 85.5 bits (210), Expect = 4e-18 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GM+GANVRT++P QR Sbjct: 99 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMSGANVRTVDPPQR 144 >ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1 [Vitis vinifera] Length = 279 Score = 88.6 bits (218), Expect = 5e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEM+GHFVEITKDRI+GMTGANVRT++P QR Sbjct: 234 DRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 279 >ref|XP_008793346.1| PREDICTED: transcription factor Pur-alpha 1-like [Phoenix dactylifera] Length = 280 Score = 88.6 bits (218), Expect = 5e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEMIGHFVEITKDR +GMTG NVRT+EPAQR Sbjct: 235 DRSSIILPLSGLKQFHEMIGHFVEITKDRFEGMTGPNVRTVEPAQR 280 >emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] Length = 291 Score = 88.6 bits (218), Expect = 6e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEM+GHFVEITKDRI+GMTGANVRT++P QR Sbjct: 246 DRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGANVRTVDPPQR 291 >gb|ONM31143.1| Transcription factor Pur-alpha 1 [Zea mays] Length = 183 Score = 86.3 bits (212), Expect = 6e-18 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEM+GHFV+I KDR++GMTGANVRT+EP+QR Sbjct: 138 DRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANVRTVEPSQR 183 >gb|PNX86412.1| transcription factor Pur-alpha 1, partial [Trifolium pratense] Length = 50 Score = 82.4 bits (202), Expect = 6e-18 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GM+ ANVRT++P QR Sbjct: 5 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMSVANVRTIDPPQR 50 >ref|XP_020241302.1| transcription factor Pur-alpha 1-like [Asparagus officinalis] gb|ONK61717.1| uncharacterized protein A4U43_C08F32830 [Asparagus officinalis] Length = 280 Score = 88.2 bits (217), Expect = 7e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEM+GHFVEITKD++DGMTGANVRTLEP R Sbjct: 235 DRSSIILPLSGLKQFHEMVGHFVEITKDKLDGMTGANVRTLEPLPR 280 >gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] Length = 298 Score = 88.2 bits (217), Expect = 9e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GMTGANVRT+EP QR Sbjct: 253 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 298 >gb|PON37210.1| Purine-rich element binding protein family [Parasponia andersonii] Length = 299 Score = 88.2 bits (217), Expect = 9e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GMTGANVRT+EP QR Sbjct: 254 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 299 >ref|XP_019705954.1| PREDICTED: transcription factor Pur-alpha 1-like isoform X2 [Elaeis guineensis] Length = 276 Score = 87.8 bits (216), Expect = 9e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE+IGHFVEITKDR++GMTG NVRT+EPAQR Sbjct: 231 DRSSIILPLSGLKQFHEIIGHFVEITKDRLEGMTGPNVRTVEPAQR 276 >ref|XP_010921295.1| PREDICTED: transcription factor Pur-alpha 1-like isoform X1 [Elaeis guineensis] Length = 280 Score = 87.8 bits (216), Expect = 9e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE+IGHFVEITKDR++GMTG NVRT+EPAQR Sbjct: 235 DRSSIILPLSGLKQFHEIIGHFVEITKDRLEGMTGPNVRTVEPAQR 280 >ref|XP_015883613.1| PREDICTED: transcription factor Pur-alpha 1 [Ziziphus jujuba] Length = 307 Score = 88.2 bits (217), Expect = 1e-17 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GMTGANVRT+EP QR Sbjct: 262 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 307 >ref|XP_024020357.1| transcription factor Pur-alpha 1 [Morus notabilis] Length = 309 Score = 88.2 bits (217), Expect = 1e-17 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GMTGANVRT+EP QR Sbjct: 264 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 309 >gb|PON45957.1| Purine-rich element binding protein family [Trema orientalis] Length = 310 Score = 88.2 bits (217), Expect = 1e-17 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GMTGANVRT+EP QR Sbjct: 265 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMTGANVRTVEPPQR 310 >gb|OVA12965.1| PUR-alpha/beta/gamma [Macleaya cordata] Length = 289 Score = 87.8 bits (216), Expect = 1e-17 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHEM+GHFVEITKDRI+GMTGA+VRT+EP QR Sbjct: 244 DRSSIILPLSGLKQFHEMVGHFVEITKDRIEGMTGASVRTVEPPQR 289 >gb|PPR92653.1| hypothetical protein GOBAR_AA28013 [Gossypium barbadense] Length = 183 Score = 85.5 bits (210), Expect = 1e-17 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = -1 Query: 509 DRSSIILPLSGLKQFHEMIGHFVEITKDRIDGMTGANVRTLEPAQR 372 DRSSIILPLSGLKQFHE++GHFVEITKDRI+GM+GANVRT++P QR Sbjct: 138 DRSSIILPLSGLKQFHEIVGHFVEITKDRIEGMSGANVRTVDPPQR 183