BLASTX nr result
ID: Cheilocostus21_contig00018521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00018521 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409020.1| PREDICTED: UPF0161 protein At3g09310 [Musa a... 81 2e-16 ref|XP_018729053.1| PREDICTED: UPF0161 protein At3g09310 [Eucaly... 80 3e-16 ref|XP_018626696.1| PREDICTED: UPF0161 protein At3g09310 isoform... 79 7e-16 ref|XP_009782346.1| PREDICTED: UPF0161 protein At3g09310 isoform... 79 7e-16 ref|XP_019254638.1| PREDICTED: UPF0161 protein At3g09310 [Nicoti... 79 8e-16 ref|XP_009782345.1| PREDICTED: UPF0161 protein At3g09310 isoform... 79 1e-15 ref|XP_009602036.1| PREDICTED: UPF0161 protein At3g09310 isoform... 79 1e-15 gb|PIA54725.1| hypothetical protein AQUCO_00900953v1 [Aquilegia ... 79 1e-15 gb|KZM83828.1| hypothetical protein DCAR_028750 [Daucus carota s... 77 1e-15 ref|XP_020276992.1| UPF0161 protein At3g09310 isoform X2 [Aspara... 79 1e-15 ref|XP_020276991.1| UPF0161 protein At3g09310 isoform X1 [Aspara... 79 1e-15 ref|XP_020113583.1| UPF0161 protein At3g09310 [Ananas comosus] >... 79 1e-15 ref|XP_020596120.1| uncharacterized protein LOC110036095 isoform... 79 1e-15 ref|XP_016488156.1| PREDICTED: UPF0161 protein At3g09310-like is... 77 3e-15 ref|XP_016736965.1| PREDICTED: UPF0161 protein At3g09310-like [G... 78 3e-15 ref|XP_016724599.1| PREDICTED: UPF0161 protein At3g09310-like [G... 78 3e-15 ref|XP_012439564.1| PREDICTED: UPF0161 protein At3g09310 [Gossyp... 78 3e-15 ref|XP_017635345.1| PREDICTED: UPF0161 protein At3g09310 [Gossyp... 78 3e-15 ref|XP_022766192.1| UPF0161 protein At3g09310 [Durio zibethinus] 78 3e-15 ref|XP_006429108.1| UPF0161 protein At3g09310 [Citrus clementina... 78 3e-15 >ref|XP_009409020.1| PREDICTED: UPF0161 protein At3g09310 [Musa acuminata subsp. malaccensis] ref|XP_009409021.1| PREDICTED: UPF0161 protein At3g09310 [Musa acuminata subsp. malaccensis] Length = 160 Score = 81.3 bits (199), Expect = 2e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GTILTAWRLCRCNPLGGTGFDPPRWFGEEE E Sbjct: 122 GVVKGTILTAWRLCRCNPLGGTGFDPPRWFGEEESFE 158 >ref|XP_018729053.1| PREDICTED: UPF0161 protein At3g09310 [Eucalyptus grandis] gb|KCW88949.1| hypothetical protein EUGRSUZ_A01276 [Eucalyptus grandis] Length = 146 Score = 80.5 bits (197), Expect = 3e-16 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWFGEE P E Sbjct: 108 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFGEERPSE 144 >ref|XP_018626696.1| PREDICTED: UPF0161 protein At3g09310 isoform X2 [Nicotiana tomentosiformis] Length = 131 Score = 79.0 bits (193), Expect = 7e-16 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEP 105 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWFGEE P Sbjct: 94 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFGEESP 128 >ref|XP_009782346.1| PREDICTED: UPF0161 protein At3g09310 isoform X2 [Nicotiana sylvestris] Length = 131 Score = 79.0 bits (193), Expect = 7e-16 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEP 105 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWFGEE P Sbjct: 94 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFGEESP 128 >ref|XP_019254638.1| PREDICTED: UPF0161 protein At3g09310 [Nicotiana attenuata] ref|XP_019254639.1| PREDICTED: UPF0161 protein At3g09310 [Nicotiana attenuata] gb|OIS97962.1| upf0161 protein [Nicotiana attenuata] Length = 153 Score = 79.3 bits (194), Expect = 8e-16 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEP 105 GVV+GTILTAWRLCRCNPLGG+GFDPPRWFGEE P Sbjct: 116 GVVKGTILTAWRLCRCNPLGGSGFDPPRWFGEESP 150 >ref|XP_009782345.1| PREDICTED: UPF0161 protein At3g09310 isoform X1 [Nicotiana sylvestris] Length = 147 Score = 79.0 bits (193), Expect = 1e-15 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEP 105 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWFGEE P Sbjct: 110 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFGEESP 144 >ref|XP_009602036.1| PREDICTED: UPF0161 protein At3g09310 isoform X1 [Nicotiana tomentosiformis] ref|XP_009602037.1| PREDICTED: UPF0161 protein At3g09310 isoform X1 [Nicotiana tomentosiformis] ref|XP_016442925.1| PREDICTED: UPF0161 protein At3g09310-like [Nicotiana tabacum] ref|XP_016442926.1| PREDICTED: UPF0161 protein At3g09310-like [Nicotiana tabacum] ref|XP_016442927.1| PREDICTED: UPF0161 protein At3g09310-like [Nicotiana tabacum] Length = 147 Score = 79.0 bits (193), Expect = 1e-15 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEP 105 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWFGEE P Sbjct: 110 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFGEESP 144 >gb|PIA54725.1| hypothetical protein AQUCO_00900953v1 [Aquilegia coerulea] Length = 150 Score = 79.0 bits (193), Expect = 1e-15 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GTILT WRLCRCNPLGG+GFDPPRWFGEE P E Sbjct: 114 GVVKGTILTGWRLCRCNPLGGSGFDPPRWFGEENPPE 150 >gb|KZM83828.1| hypothetical protein DCAR_028750 [Daucus carota subsp. sativus] Length = 72 Score = 76.6 bits (187), Expect = 1e-15 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GV +GTILTAWRLCRCNPLGG+GFDPPRWFGE P E Sbjct: 35 GVAKGTILTAWRLCRCNPLGGSGFDPPRWFGETSPPE 71 >ref|XP_020276992.1| UPF0161 protein At3g09310 isoform X2 [Asparagus officinalis] Length = 139 Score = 78.6 bits (192), Expect = 1e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GV +GTILTAWRLCRCNPLGG+GFDPPRWFGEE+P + Sbjct: 101 GVAKGTILTAWRLCRCNPLGGSGFDPPRWFGEEKPSD 137 >ref|XP_020276991.1| UPF0161 protein At3g09310 isoform X1 [Asparagus officinalis] Length = 140 Score = 78.6 bits (192), Expect = 1e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GV +GTILTAWRLCRCNPLGG+GFDPPRWFGEE+P + Sbjct: 102 GVAKGTILTAWRLCRCNPLGGSGFDPPRWFGEEKPSD 138 >ref|XP_020113583.1| UPF0161 protein At3g09310 [Ananas comosus] gb|OAY63446.1| UPF0161 protein [Ananas comosus] Length = 159 Score = 79.0 bits (193), Expect = 1e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 G V+GTILTAWR+CRCNPLGG+GFDPPRWFGE+EP E Sbjct: 122 GFVKGTILTAWRICRCNPLGGSGFDPPRWFGEQEPSE 158 >ref|XP_020596120.1| uncharacterized protein LOC110036095 isoform X2 [Phalaenopsis equestris] Length = 162 Score = 79.0 bits (193), Expect = 1e-15 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GTILTAWRLCRCNPLGG GFDPPRWFGEE+P + Sbjct: 124 GVVKGTILTAWRLCRCNPLGGHGFDPPRWFGEEKPSD 160 >ref|XP_016488156.1| PREDICTED: UPF0161 protein At3g09310-like isoform X2 [Nicotiana tabacum] Length = 131 Score = 77.4 bits (189), Expect = 3e-15 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEP 105 GVV+GT+LT WRLCRCNPLGG+GFDPPRWFGEE P Sbjct: 94 GVVKGTVLTVWRLCRCNPLGGSGFDPPRWFGEESP 128 >ref|XP_016736965.1| PREDICTED: UPF0161 protein At3g09310-like [Gossypium hirsutum] Length = 148 Score = 77.8 bits (190), Expect = 3e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWF EE+P E Sbjct: 111 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEEKPTE 147 >ref|XP_016724599.1| PREDICTED: UPF0161 protein At3g09310-like [Gossypium hirsutum] gb|PPS16611.1| hypothetical protein GOBAR_AA03968 [Gossypium barbadense] Length = 148 Score = 77.8 bits (190), Expect = 3e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWF EE+P E Sbjct: 111 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEEKPTE 147 >ref|XP_012439564.1| PREDICTED: UPF0161 protein At3g09310 [Gossypium raimondii] gb|KJB51951.1| hypothetical protein B456_008G240100 [Gossypium raimondii] gb|KJB51953.1| hypothetical protein B456_008G240100 [Gossypium raimondii] gb|KJB51954.1| hypothetical protein B456_008G240100 [Gossypium raimondii] gb|KJB51956.1| hypothetical protein B456_008G240100 [Gossypium raimondii] gb|KJB51957.1| hypothetical protein B456_008G240100 [Gossypium raimondii] Length = 148 Score = 77.8 bits (190), Expect = 3e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWF EE+P E Sbjct: 111 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEEKPTE 147 >ref|XP_017635345.1| PREDICTED: UPF0161 protein At3g09310 [Gossypium arboreum] gb|KHF98269.1| hypothetical protein F383_12842 [Gossypium arboreum] Length = 148 Score = 77.8 bits (190), Expect = 3e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWF EE+P E Sbjct: 111 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEEKPTE 147 >ref|XP_022766192.1| UPF0161 protein At3g09310 [Durio zibethinus] Length = 150 Score = 77.8 bits (190), Expect = 3e-15 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHE 111 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWF EE+P E Sbjct: 113 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEEKPTE 149 >ref|XP_006429108.1| UPF0161 protein At3g09310 [Citrus clementina] gb|ESR42346.1| hypothetical protein CICLE_v10012381mg [Citrus clementina] gb|ESR42348.1| hypothetical protein CICLE_v10012381mg [Citrus clementina] Length = 154 Score = 77.8 bits (190), Expect = 3e-15 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 GVVRGTILTAWRLCRCNPLGGTGFDPPRWFGEEEPHEL 114 GVV+GT+LTAWRLCRCNPLGG+GFDPPRWF EE P E+ Sbjct: 117 GVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEESPPEV 154