BLASTX nr result
ID: Cheilocostus21_contig00018267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00018267 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009416210.1| PREDICTED: coronatine-insensitive protein ho... 69 3e-10 ref|XP_010905359.1| PREDICTED: coronatine-insensitive protein ho... 63 2e-08 ref|XP_008812874.1| PREDICTED: coronatine-insensitive protein ho... 63 2e-08 ref|XP_009407559.1| PREDICTED: coronatine-insensitive protein ho... 62 6e-08 ref|XP_009407558.1| PREDICTED: coronatine-insensitive protein ho... 62 6e-08 ref|XP_010907624.1| PREDICTED: coronatine-insensitive protein ho... 62 8e-08 ref|XP_008775055.1| PREDICTED: coronatine-insensitive protein ho... 60 2e-07 ref|XP_009402286.1| PREDICTED: coronatine-insensitive protein ho... 57 2e-06 ref|XP_009402285.2| PREDICTED: coronatine-insensitive protein ho... 57 2e-06 ref|XP_008812756.1| PREDICTED: coronatine-insensitive protein ho... 57 3e-06 ref|XP_020101802.1| coronatine-insensitive protein homolog 1b [A... 57 4e-06 gb|OAY66212.1| Coronatine-insensitive protein 1 [Ananas comosus] 57 4e-06 >ref|XP_009416210.1| PREDICTED: coronatine-insensitive protein homolog 1b [Musa acuminata subsp. malaccensis] Length = 587 Score = 68.6 bits (166), Expect = 3e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 1 IEGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 IE RRGNIESQAQILAYYSL GKRTDCP +VIPLYP Sbjct: 551 IEDRRGNIESQAQILAYYSLAGKRTDCPETVIPLYP 586 >ref|XP_010905359.1| PREDICTED: coronatine-insensitive protein homolog 1a-like [Elaeis guineensis] Length = 590 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 4 EGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 E RRG +ESQAQILAYYSL G+RTDCP +VIPLYP Sbjct: 554 EDRRGGVESQAQILAYYSLAGRRTDCPETVIPLYP 588 >ref|XP_008812874.1| PREDICTED: coronatine-insensitive protein homolog 1b-like [Phoenix dactylifera] Length = 590 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 4 EGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 E RRG ++SQAQILAYYSL G+RTDCP SVIPLYP Sbjct: 554 EDRRGGVDSQAQILAYYSLAGRRTDCPESVIPLYP 588 >ref|XP_009407559.1| PREDICTED: coronatine-insensitive protein homolog 1b isoform X2 [Musa acuminata subsp. malaccensis] Length = 583 Score = 62.0 bits (149), Expect = 6e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 4 EGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 E R GNIESQAQILAYYSL GKRTDC SVIPLYP Sbjct: 548 EVRTGNIESQAQILAYYSLAGKRTDCSESVIPLYP 582 >ref|XP_009407558.1| PREDICTED: coronatine-insensitive protein homolog 1b isoform X1 [Musa acuminata subsp. malaccensis] Length = 601 Score = 62.0 bits (149), Expect = 6e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 4 EGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 E R GNIESQAQILAYYSL GKRTDC SVIPLYP Sbjct: 566 EVRTGNIESQAQILAYYSLAGKRTDCSESVIPLYP 600 >ref|XP_010907624.1| PREDICTED: coronatine-insensitive protein homolog 1b [Elaeis guineensis] Length = 580 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 IEGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 ++ R G IESQAQILAYYSL GKRTDCP SV+PLYP Sbjct: 544 LDDRPGAIESQAQILAYYSLAGKRTDCPESVVPLYP 579 >ref|XP_008775055.1| PREDICTED: coronatine-insensitive protein homolog 1b-like [Phoenix dactylifera] ref|XP_017702456.1| PREDICTED: coronatine-insensitive protein homolog 1b-like [Phoenix dactylifera] Length = 580 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 IEGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 ++ R G IES+AQILAYYSL GKRTDCP SV+PLYP Sbjct: 544 LDDRLGAIESRAQILAYYSLAGKRTDCPDSVVPLYP 579 >ref|XP_009402286.1| PREDICTED: coronatine-insensitive protein homolog 1b-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 588 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 22 IESQAQILAYYSLVGKRTDCPGSVIPLYPT*VSHI 126 +E+QAQILAYYSLVG+RTDCP SVIPLYP H+ Sbjct: 554 VEAQAQILAYYSLVGRRTDCPESVIPLYPASSVHM 588 >ref|XP_009402285.2| PREDICTED: coronatine-insensitive protein homolog 1b-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 735 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 22 IESQAQILAYYSLVGKRTDCPGSVIPLYPT*VSHI 126 +E+QAQILAYYSLVG+RTDCP SVIPLYP H+ Sbjct: 701 VEAQAQILAYYSLVGRRTDCPESVIPLYPASSVHM 735 >ref|XP_008812756.1| PREDICTED: coronatine-insensitive protein homolog 1a-like [Phoenix dactylifera] Length = 590 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 4 EGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 E RRG +ES AQILAYYSL G+RTD P SVIPLYP Sbjct: 554 EDRRGGVESPAQILAYYSLSGRRTDYPESVIPLYP 588 >ref|XP_020101802.1| coronatine-insensitive protein homolog 1b [Ananas comosus] Length = 596 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 1 IEGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 ++ R ESQAQILAYYSL GKR DCP SVIPLYP Sbjct: 560 VDDRPAGAESQAQILAYYSLAGKRLDCPESVIPLYP 595 >gb|OAY66212.1| Coronatine-insensitive protein 1 [Ananas comosus] Length = 622 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 1 IEGRRGNIESQAQILAYYSLVGKRTDCPGSVIPLYP 108 ++ R ESQAQILAYYSL GKR DCP SVIPLYP Sbjct: 586 VDDRPAGAESQAQILAYYSLAGKRLDCPESVIPLYP 621