BLASTX nr result
ID: Cheilocostus21_contig00018255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00018255 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315143.2| hypothetical protein POPTR_0010s19270g [Popu... 57 2e-06 ref|XP_008811683.1| PREDICTED: protein MALE DISCOVERER 2 [Phoeni... 55 8e-06 >ref|XP_002315143.2| hypothetical protein POPTR_0010s19270g [Populus trichocarpa] gb|PNT17318.1| hypothetical protein POPTR_010G185300v3 [Populus trichocarpa] Length = 649 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/54 (51%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 277 LKMEKWLFNMLFVVPWFPLAY-LQLCASLNEDGRALLAIKEKIIVDPFGALSSW 435 ++++ W FN L VV F L L LC+SLNE+G ALL ++E+I+ DP+GAL+SW Sbjct: 1 MEIKNWKFNRLGVVILFLLYQNLILCSSLNEEGMALLRLRERIVSDPYGALNSW 54 >ref|XP_008811683.1| PREDICTED: protein MALE DISCOVERER 2 [Phoenix dactylifera] Length = 469 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 283 MEKW-LFNMLFVVPWFPLAY--LQLCASLNEDGRALLAIKEKIIVDPFGALSSW 435 ME+W L M + W L Y L+LC S+N +GRALL KE++ VDP GALS+W Sbjct: 1 MERWRLLQMGSFLLWVALVYQRLELCVSINAEGRALLRFKERVEVDPHGALSNW 54