BLASTX nr result
ID: Cheilocostus21_contig00017989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017989 (724 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412360.1| PREDICTED: uncharacterized protein LOC103993... 69 7e-10 >ref|XP_009412360.1| PREDICTED: uncharacterized protein LOC103993870 [Musa acuminata subsp. malaccensis] Length = 470 Score = 69.3 bits (168), Expect = 7e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 723 VVGVIFTSEKIQEIIPISSNSCLVLCQGNMFIYGV 619 VVG IFTSEKIQE++P+SSNSCLVLCQGNMFIYGV Sbjct: 435 VVGAIFTSEKIQEVVPMSSNSCLVLCQGNMFIYGV 469