BLASTX nr result
ID: Cheilocostus21_contig00017524
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017524 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399852.1| PREDICTED: E3 ubiquitin-protein ligase SINAT... 78 3e-14 ref|XP_022896476.1| E3 ubiquitin-protein ligase SINAT3-like isof... 74 1e-12 gb|PKI64170.1| hypothetical protein CRG98_015445, partial [Punic... 70 1e-12 gb|ACJ84732.1| unknown [Medicago truncatula] 70 1e-12 ref|XP_022896475.1| E3 ubiquitin-protein ligase SINAT5-like isof... 74 1e-12 gb|EPS72485.1| hypothetical protein M569_02273 [Genlisea aurea] 74 1e-12 ref|XP_011093030.1| E3 ubiquitin-protein ligase SINAT5 [Sesamum ... 74 1e-12 gb|PIN12381.1| Zn finger protein [Handroanthus impetiginosus] 74 1e-12 ref|XP_011093868.1| E3 ubiquitin-protein ligase SINAT5 [Sesamum ... 74 1e-12 ref|XP_019229126.1| PREDICTED: E3 ubiquitin-protein ligase SINAT... 74 1e-12 ref|XP_009607471.1| PREDICTED: E3 ubiquitin-protein ligase SINAT... 74 1e-12 ref|XP_009768953.1| PREDICTED: E3 ubiquitin-protein ligase SINAT... 74 1e-12 gb|OTG20333.1| putative E3 ubiquitin-protein ligase SIN-like, Zi... 72 3e-12 ref|XP_021971498.1| E3 ubiquitin-protein ligase SINAT3-like [Hel... 72 3e-12 gb|PIN17340.1| Zn finger protein [Handroanthus impetiginosus] 72 5e-12 ref|XP_022035695.1| E3 ubiquitin-protein ligase SINAT5-like [Hel... 72 5e-12 gb|ONI25575.1| hypothetical protein PRUPE_2G310100 [Prunus persica] 70 6e-12 gb|OVA14704.1| zinc finger protein [Macleaya cordata] 72 6e-12 gb|OVA00958.1| zinc finger protein [Macleaya cordata] 72 6e-12 ref|XP_010267615.1| PREDICTED: E3 ubiquitin-protein ligase SINAT... 72 6e-12 >ref|XP_009399852.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5-like [Musa acuminata subsp. malaccensis] Length = 324 Score = 78.2 bits (191), Expect = 3e-14 Identities = 42/85 (49%), Positives = 44/85 (51%) Frame = +2 Query: 185 MESYNIECXXXXXXXXXXXXXXXXXXTRVARPFFKPHXXXXXXXXXXXXXXXXXINPATR 364 MES NIEC V PF KPH ++PATR Sbjct: 1 MESDNIECISVSDATVVDDEEV----AHVPHPFLKPHGDGSGTVAGGGRSPV--MSPATR 54 Query: 365 VHELLECPVCTNSMYPPIHQCHNGH 439 VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 55 VHELLECPVCTNSMYPPIHQCHNGH 79 >ref|XP_022896476.1| E3 ubiquitin-protein ligase SINAT3-like isoform X2 [Olea europaea var. sylvestris] Length = 290 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 42 INPATSVHELLECPVCTNSMYPPIHQCHNGH 72 >gb|PKI64170.1| hypothetical protein CRG98_015445, partial [Punica granatum] Length = 136 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 I PAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 75 IAPATSVHELLECPVCTNSMYPPIHQCHNGH 105 >gb|ACJ84732.1| unknown [Medicago truncatula] Length = 138 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 I PAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 51 IAPATSVHELLECPVCTNSMYPPIHQCHNGH 81 >ref|XP_022896475.1| E3 ubiquitin-protein ligase SINAT5-like isoform X1 [Olea europaea var. sylvestris] Length = 316 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 42 INPATSVHELLECPVCTNSMYPPIHQCHNGH 72 >gb|EPS72485.1| hypothetical protein M569_02273 [Genlisea aurea] Length = 316 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 43 INPATSVHELLECPVCTNSMYPPIHQCHNGH 73 >ref|XP_011093030.1| E3 ubiquitin-protein ligase SINAT5 [Sesamum indicum] ref|XP_020553370.1| E3 ubiquitin-protein ligase SINAT5 [Sesamum indicum] Length = 321 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 48 INPATSVHELLECPVCTNSMYPPIHQCHNGH 78 >gb|PIN12381.1| Zn finger protein [Handroanthus impetiginosus] Length = 322 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 48 INPATSVHELLECPVCTNSMYPPIHQCHNGH 78 >ref|XP_011093868.1| E3 ubiquitin-protein ligase SINAT5 [Sesamum indicum] Length = 323 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 49 INPATSVHELLECPVCTNSMYPPIHQCHNGH 79 >ref|XP_019229126.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5 [Nicotiana attenuata] gb|OIT07427.1| e3 ubiquitin-protein ligase sinat3 [Nicotiana attenuata] Length = 330 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 56 INPATSVHELLECPVCTNSMYPPIHQCHNGH 86 >ref|XP_009607471.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5 [Nicotiana tomentosiformis] ref|XP_016463948.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5-like [Nicotiana tabacum] ref|XP_018628115.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5 [Nicotiana tomentosiformis] Length = 330 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 56 INPATSVHELLECPVCTNSMYPPIHQCHNGH 86 >ref|XP_009768953.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5 [Nicotiana sylvestris] ref|XP_016502098.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5-like [Nicotiana tabacum] Length = 331 Score = 73.6 bits (179), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INPAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 57 INPATSVHELLECPVCTNSMYPPIHQCHNGH 87 >gb|OTG20333.1| putative E3 ubiquitin-protein ligase SIN-like, Zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 255 Score = 72.0 bits (175), Expect = 3e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INP T VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 56 INPTTSVHELLECPVCTNSMYPPIHQCHNGH 86 >ref|XP_021971498.1| E3 ubiquitin-protein ligase SINAT3-like [Helianthus annuus] Length = 267 Score = 72.0 bits (175), Expect = 3e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INP T VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 68 INPTTSVHELLECPVCTNSMYPPIHQCHNGH 98 >gb|PIN17340.1| Zn finger protein [Handroanthus impetiginosus] Length = 321 Score = 72.0 bits (175), Expect = 5e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INP T VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 48 INPTTSVHELLECPVCTNSMYPPIHQCHNGH 78 >ref|XP_022035695.1| E3 ubiquitin-protein ligase SINAT5-like [Helianthus annuus] gb|OTG29283.1| putative E3 ubiquitin-protein ligase SIN-like, Zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 331 Score = 72.0 bits (175), Expect = 5e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 INP T VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 56 INPTTSVHELLECPVCTNSMYPPIHQCHNGH 86 >gb|ONI25575.1| hypothetical protein PRUPE_2G310100 [Prunus persica] Length = 221 Score = 70.5 bits (171), Expect = 6e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 I PAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 59 IAPATSVHELLECPVCTNSMYPPIHQCHNGH 89 >gb|OVA14704.1| zinc finger protein [Macleaya cordata] Length = 312 Score = 71.6 bits (174), Expect = 6e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 I+PAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 38 ISPATSVHELLECPVCTNSMYPPIHQCHNGH 68 >gb|OVA00958.1| zinc finger protein [Macleaya cordata] Length = 312 Score = 71.6 bits (174), Expect = 6e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 I+PAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 38 ISPATSVHELLECPVCTNSMYPPIHQCHNGH 68 >ref|XP_010267615.1| PREDICTED: E3 ubiquitin-protein ligase SINAT5-like [Nelumbo nucifera] Length = 312 Score = 71.6 bits (174), Expect = 6e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 347 INPATRVHELLECPVCTNSMYPPIHQCHNGH 439 I+PAT VHELLECPVCTNSMYPPIHQCHNGH Sbjct: 38 ISPATSVHELLECPVCTNSMYPPIHQCHNGH 68