BLASTX nr result
ID: Cheilocostus21_contig00017471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017471 (866 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CUP73950.1| Uncharacterised protein [Dorea longicatena] 199 8e-61 emb|CDQ29749.1| hypothetical protein BN981_04176 [Halobacillus t... 197 4e-60 dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE6... 199 8e-60 emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria mening... 197 2e-59 emb|SCH67013.1| Uncharacterised protein [uncultured Ruminococcus... 196 2e-59 emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria mening... 196 4e-59 emb|CUN08920.1| Uncharacterised protein [Blautia hydrogenotrophi... 195 4e-59 emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria mening... 196 6e-59 gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkho... 196 7e-59 dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE6... 196 7e-59 emb|CWO51373.1| Cell wall-associated hydrolase [Neisseria mening... 195 1e-58 gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningi... 195 1e-58 emb|SCH14795.1| Uncharacterised protein [uncultured Clostridium ... 194 1e-58 emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria mening... 195 2e-58 emb|CWP48701.1| Cell wall-associated hydrolase [Neisseria mening... 195 2e-58 emb|CNS09044.1| Cell wall-associated hydrolase [Neisseria gonorr... 195 2e-58 emb|SCJ81459.1| Uncharacterised protein [uncultured Blautia sp.] 192 3e-58 gb|EOS72256.1| hypothetical protein C819_04359 [Lachnospiraceae ... 193 3e-58 emb|CUQ62957.1| Uncharacterised protein [Fusicatenibacter sp. 27... 193 3e-58 emb|SCI72369.1| Uncharacterised protein [uncultured Clostridium ... 192 4e-58 >emb|CUP73950.1| Uncharacterised protein [Dorea longicatena] Length = 169 Score = 199 bits (507), Expect = 8e-61 Identities = 111/169 (65%), Positives = 115/169 (68%), Gaps = 4/169 (2%) Frame = -1 Query: 632 LGLYEAAAPAVVERSLKYQPSLI*SLT----PCGEQCLVGSLTGAVAS*SVTEAFKGMLS 465 +G YE P E L Y P I LT P QC GSLTGAVAS V+EA KG L Sbjct: 1 MGDYETVTPVAAESMLGYHPCSIGFLTCAREPGSGQCQAGSLTGAVASERVSEAPKGSLR 60 Query: 464 TVGNRTWSAIVQACLTVRPTGRAGAKAGYSDPVVLHGRAIAQRIKGTLGITG*SPPRVHI 285 VGN + SA + LTV PTG AG K G SDPVVL G AIAQRIK TLGITG S PRVHI Sbjct: 61 MVGNHSQSAKAEGSLTVTPTGGAGTKVGLSDPVVLSGNAIAQRIKATLGITGLSLPRVHI 120 Query: 284 DGEVWHLDVGSSHPGAGEGPKGSAVRRLKWYASWVQNVVRQFGPYLPWA 138 DG VWHLDVGSSHPGA GPKG AVR LK YASWVQNVVRQFGPY WA Sbjct: 121 DGVVWHLDVGSSHPGAVVGPKGWAVRPLKRYASWVQNVVRQFGPYPAWA 169 >emb|CDQ29749.1| hypothetical protein BN981_04176 [Halobacillus trueperi] Length = 157 Score = 197 bits (501), Expect = 4e-60 Identities = 102/138 (73%), Positives = 104/138 (75%) Frame = -1 Query: 551 PCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWSAIVQACLTVRPTGRAGAKAGYSD 372 P QC VGSLTGAVAS VTEA KG L VGN + S Q LT RPT RAG K G SD Sbjct: 17 PVRRQCQVGSLTGAVASQKVTEAPKGSLRMVGNHSQSVKAQGSLTARPTSRAGTKVGLSD 76 Query: 371 PVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLDVGSSHPGAGEGPKGSAVRRLKWY 192 P V HGRA+AQRIK T GITG SPPRVHIDGEVWHLDVGSSHPGA GPKG AVR LK Y Sbjct: 77 PAVPHGRAVAQRIKATPGITGLSPPRVHIDGEVWHLDVGSSHPGAVVGPKGWAVRPLKRY 136 Query: 191 ASWVQNVVRQFGPYLPWA 138 ASWVQNVVRQFGPY WA Sbjct: 137 ASWVQNVVRQFGPYPSWA 154 >dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO88159.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO90886.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 199 bits (506), Expect(2) = 8e-60 Identities = 108/186 (58%), Positives = 122/186 (65%), Gaps = 4/186 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRT+L GEQP PWD LQPQD MSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY LL H + ++PY AYL PPLH Sbjct: 103 SPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLH 162 Query: 497 FRRQPPQLNYPPGTVPRKG----LDSKSKKVGISTTSPQRLAPLLRRVPTILHIRNSKSI 664 F R+PPQ N P TVP L+ ++ + GIS T+P RLA +P ILH + Sbjct: 163 FGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSVQSPM 222 Query: 665 PSCSKG 682 S SKG Sbjct: 223 QSYSKG 228 Score = 60.8 bits (146), Expect(2) = 8e-60 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSAVI S HSYPA LA + VHQR+VH GPLVLGA P K P Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTP 44 >emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ03425.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 197 bits (501), Expect = 2e-59 Identities = 106/173 (61%), Positives = 118/173 (68%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 29 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 88 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 89 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 148 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL+ +P ILH Sbjct: 149 FGRRPPQSNCLPCTVPDPDDESGLEPQRHQGGISRTAPQRLASLLQSLPPILH 201 >emb|SCH67013.1| Uncharacterised protein [uncultured Ruminococcus sp.] Length = 164 Score = 196 bits (497), Expect = 2e-59 Identities = 108/161 (67%), Positives = 112/161 (69%), Gaps = 4/161 (2%) Frame = -1 Query: 608 PAVVERSLKYQPSLI*SLT----PCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWS 441 P +E L Y P LT P G QC VGSLTGAVAS V+EA KG L VGN + S Sbjct: 4 PVAMEPLLGYHPCSTGFLTSSRDPAGGQCQVGSLTGAVASERVSEALKGSLRMVGNHSKS 63 Query: 440 AIVQACLTVRPTGRAGAKAGYSDPVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLD 261 A + LT PTG AG K G SDPVVL G AIAQRIK TLGITG S PRVHIDG VWHLD Sbjct: 64 AKAEGSLTATPTGGAGTKVGLSDPVVLSGNAIAQRIKATLGITGLSLPRVHIDGVVWHLD 123 Query: 260 VGSSHPGAGEGPKGSAVRRLKWYASWVQNVVRQFGPYLPWA 138 VGSSHPGA GPKG AVR LK YASWVQNVVRQFGPY WA Sbjct: 124 VGSSHPGAVVGPKGWAVRPLKRYASWVQNVVRQFGPYPAWA 164 >emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP44468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT59196.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS83033.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP46906.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP27798.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN98251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ04956.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT93866.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP96790.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT92957.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR69071.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN70881.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN17584.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ42038.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP73355.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO79925.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR78282.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS37293.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO16958.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 196 bits (499), Expect = 4e-59 Identities = 106/173 (61%), Positives = 118/173 (68%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 29 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 88 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 89 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 148 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL+ +P ILH Sbjct: 149 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILH 201 >emb|CUN08920.1| Uncharacterised protein [Blautia hydrogenotrophica] emb|SCI07231.1| Uncharacterised protein [uncultured Blautia sp.] Length = 164 Score = 195 bits (495), Expect = 4e-59 Identities = 108/161 (67%), Positives = 112/161 (69%), Gaps = 4/161 (2%) Frame = -1 Query: 608 PAVVERSLKYQPSLI*SLT----PCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWS 441 P E +L Y P I LT P G QC VGSLTGAVAS V+EA KG L GN + S Sbjct: 4 PVFTESALGYHPCGIGFLTSSRDPAGGQCQVGSLTGAVASERVSEALKGSLRMDGNHSKS 63 Query: 440 AIVQACLTVRPTGRAGAKAGYSDPVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLD 261 A + LT PTG AG K G SDPVVL G AIAQRIK TLGITG S PRVHIDG VWHLD Sbjct: 64 AKAEGSLTATPTGGAGTKVGLSDPVVLSGNAIAQRIKATLGITGLSLPRVHIDGVVWHLD 123 Query: 260 VGSSHPGAGEGPKGSAVRRLKWYASWVQNVVRQFGPYLPWA 138 VGSSHPGA GPKG AVR LK YASWVQNVVRQFGPY WA Sbjct: 124 VGSSHPGAVVGPKGWAVRPLKRYASWVQNVVRQFGPYPAWA 164 >emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65376.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO43812.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS31701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR93279.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT88142.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP62169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO09337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS97823.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 196 bits (499), Expect = 6e-59 Identities = 106/173 (61%), Positives = 118/173 (68%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 103 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 162 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL+ +P ILH Sbjct: 163 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILH 215 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSA+I S SYPA LA + VHQR+VH GPLVLGA P+KL P Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTP 44 >gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 196 bits (498), Expect(2) = 7e-59 Identities = 107/186 (57%), Positives = 121/186 (65%), Gaps = 4/186 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRT+L GEQP PWD LQPQD MSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY LL H + ++PY AYL PPL Sbjct: 103 SPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLCTPPLR 162 Query: 497 FRRQPPQLNYPPGTVPRKG----LDSKSKKVGISTTSPQRLAPLLRRVPTILHIRNSKSI 664 F R+PPQ N P TVP L+ ++ + GIS T+P RLA +P ILH + Sbjct: 163 FGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHKSVQNPM 222 Query: 665 PSCSKG 682 S SKG Sbjct: 223 QSYSKG 228 Score = 60.8 bits (146), Expect(2) = 7e-59 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSAVI S HSYPA LA + VHQR+VH GPLVLGA P K P Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTP 44 >dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87487.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87598.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 196 bits (498), Expect(2) = 7e-59 Identities = 107/186 (57%), Positives = 121/186 (65%), Gaps = 4/186 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRT+L GEQP PWD LQPQD MSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY LL H + ++PY AYL PPL Sbjct: 103 SPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLR 162 Query: 497 FRRQPPQLNYPPGTVPRKG----LDSKSKKVGISTTSPQRLAPLLRRVPTILHIRNSKSI 664 F R+PPQ N P TVP L+ ++ + GIS T+P RLA +P ILH + Sbjct: 163 FGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSVQSPM 222 Query: 665 PSCSKG 682 S SKG Sbjct: 223 QSYSKG 228 Score = 60.8 bits (146), Expect(2) = 7e-59 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSAVI S HSYPA LA + VHQR+VH GPLVLGA P K P Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTP 44 >emb|CWO51373.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 195 bits (496), Expect = 1e-58 Identities = 106/173 (61%), Positives = 117/173 (67%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 29 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 88 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 89 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLLVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 148 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL +P ILH Sbjct: 149 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILH 201 >gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gb|EJU61973.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gb|EJU62544.1| cell wall-associated hydrolase [Neisseria meningitidis 69166] gb|ELK74541.1| hypothetical protein NM2006087_0256 [Neisseria meningitidis 2006087] gb|ELL00985.1| hypothetical protein NM12888_1665 [Neisseria meningitidis 12888] emb|CWO33360.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS22460.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT52492.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO87056.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP11771.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR97728.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN57532.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP67952.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM35585.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN41524.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWU00589.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ40111.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT04099.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP26351.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT63701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS70177.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO22916.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP54997.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS22406.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR45207.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP53785.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03678.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT87473.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP91498.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN67092.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO96602.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO95311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT55895.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT13818.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48902.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS33681.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP78000.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO12897.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS86296.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP20575.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT29169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP63785.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS84972.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP92574.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP59033.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT49266.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS27719.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM46796.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN46619.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ68119.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15682.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ08477.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS17962.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP30862.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO42413.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR29661.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO31337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ04898.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP10150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM05078.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM12681.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT61744.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN57772.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR90150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT16329.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR30726.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT07011.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP52443.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN21252.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN45814.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN19844.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ43419.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR10684.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR33680.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO48013.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT37813.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP53477.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP86780.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT58035.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN17637.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN08518.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS23659.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR26094.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT34423.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP99181.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36926.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM80848.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN88221.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ99732.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO40610.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO11922.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR49944.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR50940.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ80168.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP28080.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36757.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN29027.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO57148.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS94689.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO86275.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34667.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN65467.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ62273.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR08251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT18242.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP36630.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT70851.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ29131.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM14786.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ17869.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP41619.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT32077.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 195 bits (496), Expect = 1e-58 Identities = 106/173 (61%), Positives = 117/173 (67%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 29 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 88 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 89 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 148 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL +P ILH Sbjct: 149 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILH 201 >emb|SCH14795.1| Uncharacterised protein [uncultured Clostridium sp.] emb|SCI95335.1| Uncharacterised protein [uncultured Clostridium sp.] Length = 164 Score = 194 bits (492), Expect = 1e-58 Identities = 108/161 (67%), Positives = 112/161 (69%), Gaps = 4/161 (2%) Frame = -1 Query: 608 PAVVERSLKYQPSLI*SLT----PCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWS 441 P +E L Y P I LT P QC GSLTGAVAS V+EA KG L VGN + S Sbjct: 4 PVAMEPMLGYHPCSIGFLTSHRDPVIGQCQAGSLTGAVASERVSEALKGSLRMVGNHSKS 63 Query: 440 AIVQACLTVRPTGRAGAKAGYSDPVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLD 261 A + LTV PTG AG K G SDPVVL G AIAQRIK TLGITG S PRVHIDG VWHLD Sbjct: 64 AKAEGSLTVTPTGGAGTKVGLSDPVVLSGNAIAQRIKATLGITGLSLPRVHIDGVVWHLD 123 Query: 260 VGSSHPGAGEGPKGSAVRRLKWYASWVQNVVRQFGPYLPWA 138 VGSSHPGA GPKG AVR LK YASWVQNVVRQFGPY WA Sbjct: 124 VGSSHPGAVVGPKGWAVRPLKRYASWVQNVVRQFGPYPAWA 164 >emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS73015.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48004.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT53749.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP56073.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45211.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP40556.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34214.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 195 bits (496), Expect = 2e-58 Identities = 106/173 (61%), Positives = 117/173 (67%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 103 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLLVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 162 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL +P ILH Sbjct: 163 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILH 215 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSA+I S SYPA LA + VHQR+VH GPLVLGA P+KL P Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTP 44 >emb|CWP48701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR29009.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR82218.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR46809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS91548.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN30464.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN27922.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS66742.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR06838.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR48486.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR10327.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN24095.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO60614.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN25947.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS98001.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS59497.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN72848.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP39092.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ32365.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR13329.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR32013.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO60288.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO73300.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO97724.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM32626.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR46169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR60621.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS55187.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO74333.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS49369.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN33205.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT97847.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO92715.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT28786.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS90747.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM57104.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS63743.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO03883.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS61697.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO81400.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT19600.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS68250.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO24807.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT09763.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR74708.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP19917.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP84832.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03601.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS70498.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN63518.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36222.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR66421.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO88263.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO98192.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS47444.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT98357.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS64753.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS46428.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS76708.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO66988.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM84030.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR78250.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34318.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT95575.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM57972.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ57771.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ39864.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO66358.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM94174.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP76809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO82057.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO41141.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO43448.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR92606.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO68101.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03041.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR09158.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ50251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR40772.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO02003.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN69442.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM99199.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS97164.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO86758.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS41307.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT95437.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM63050.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP38428.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM29569.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR37263.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR81410.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT48259.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM97468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN50119.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM76951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN34996.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65665.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP39424.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ41661.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN92488.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ79228.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM13605.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT09979.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT10765.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN20861.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT20193.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP85087.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ46953.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO47217.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR53907.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN72701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT19570.1| Cell wall-associated hydrolase [Neisseria meningitidis] gb|ANW90621.1| hypothetical protein DE8555_0048 [Neisseria meningitidis] gb|ANW92138.1| hypothetical protein DE8555_1596 [Neisseria meningitidis] gb|ANW92423.1| hypothetical protein DE8555_1889 [Neisseria meningitidis] gb|ANW92538.1| hypothetical protein DE8555_2009 [Neisseria meningitidis] Length = 216 Score = 195 bits (496), Expect = 2e-58 Identities = 106/173 (61%), Positives = 117/173 (67%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 103 SPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 162 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL +P ILH Sbjct: 163 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILH 215 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSA+I S SYPA LA + VHQR+VH GPLVLGA P+KL P Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTP 44 >emb|CNS09044.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN05702.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN12195.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN08284.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN16001.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBM98005.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN00296.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN07672.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBM92021.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBM98469.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN02983.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN10314.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN06757.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 216 Score = 195 bits (496), Expect = 2e-58 Identities = 106/173 (61%), Positives = 117/173 (67%), Gaps = 4/173 (2%) Frame = +2 Query: 137 TPTADRDRTVSRRSEPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPPRRYELLGEISLL 316 TPTADRD+TVSRR +PSSRTTL GEQP PWD LQPQDVMSRHRGAK RRYELLG ISLL Sbjct: 43 TPTADRDQTVSRRFKPSSRTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLL 102 Query: 317 SPEYLLSVERWPFHAEPPDHYILL*HQXXXXXXXXXXXXXXXXTYGYQPY*AYL*KPPLH 496 SPEYLLSVERWPFH EPPDHY+LL H ++P L PPL Sbjct: 103 SPEYLLSVERWPFHTEPPDHYVLLSHLPDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLR 162 Query: 497 FRRQPPQLNYPPGTVP----RKGLDSKSKKVGISTTSPQRLAPLLRRVPTILH 643 F R+PPQ N P TVP GL+ + + GIS T+PQRLA LL +P ILH Sbjct: 163 FGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTTPQRLASLLPSLPPILH 215 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 12 MLSAVIPSIHSYPAALLAERQVHQRYVHPGPLVLGATPLKLRRP 143 MLSA+I S SYPA LA + VHQR+VH GPLVLGA P+KL P Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTP 44 >emb|SCJ81459.1| Uncharacterised protein [uncultured Blautia sp.] Length = 154 Score = 192 bits (489), Expect = 3e-58 Identities = 102/141 (72%), Positives = 105/141 (74%) Frame = -1 Query: 560 SLTPCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWSAIVQACLTVRPTGRAGAKAG 381 S P G QC VGSLTGAVAS V+EA KG L VGN + SA + LT PTG AG K G Sbjct: 14 SRDPAGGQCQVGSLTGAVASERVSEALKGSLRMVGNHSKSAKAEGSLTATPTGGAGTKVG 73 Query: 380 YSDPVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLDVGSSHPGAGEGPKGSAVRRL 201 SDPVVL G AIAQRIK TLGITG S PRVHIDG VWHLDVGSSHPGA GPKG AVR L Sbjct: 74 LSDPVVLSGNAIAQRIKATLGITGLSLPRVHIDGVVWHLDVGSSHPGAVVGPKGWAVRPL 133 Query: 200 KWYASWVQNVVRQFGPYLPWA 138 K YASWVQNVVRQFGPY WA Sbjct: 134 KRYASWVQNVVRQFGPYPAWA 154 >gb|EOS72256.1| hypothetical protein C819_04359 [Lachnospiraceae bacterium 10-1] Length = 165 Score = 193 bits (490), Expect = 3e-58 Identities = 100/140 (71%), Positives = 107/140 (76%), Gaps = 2/140 (1%) Frame = -1 Query: 551 PCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWSAIVQACLTVRPTGRAGAKAGYSD 372 P C +GSLTGAVAS VTEAFKG L VGN + SA + LT RPTGRAG K G SD Sbjct: 26 PASGHCQMGSLTGAVASERVTEAFKGSLRMVGNHSQSAKAEGSLTARPTGRAGRKLGLSD 85 Query: 371 PVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLDVGSSHPGAGE--GPKGSAVRRLK 198 P V +G A+AQRIK T GITG SPPRVHIDGEVWHLDVGSSHPGAG GPKG AVR+LK Sbjct: 86 PAVENGIAVAQRIKATSGITGLSPPRVHIDGEVWHLDVGSSHPGAGAGVGPKGLAVRQLK 145 Query: 197 WYASWVQNVVRQFGPYLPWA 138 +ASWVQNVVRQFGPY WA Sbjct: 146 RHASWVQNVVRQFGPYPSWA 165 >emb|CUQ62957.1| Uncharacterised protein [Fusicatenibacter sp. 2789STDY5834925] Length = 167 Score = 193 bits (490), Expect = 3e-58 Identities = 107/157 (68%), Positives = 111/157 (70%), Gaps = 4/157 (2%) Frame = -1 Query: 608 PAVVERSLKYQPSLI*SLT----PCGEQCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWS 441 P ++E L Y I LT P G QCL GSLTGAVAS V+EA KG L VGN S Sbjct: 4 PVIMESMLGYHSCSIGFLTCARDPGGGQCLAGSLTGAVASERVSEALKGSLRMVGNHPKS 63 Query: 440 AIVQACLTVRPTGRAGAKAGYSDPVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLD 261 A + LTV PTG AG K G SDPVVL G AIAQRIK TLGITG S PRVHIDG VWHLD Sbjct: 64 AKAEGSLTVTPTGGAGTKVGLSDPVVLSGNAIAQRIKATLGITGLSLPRVHIDGVVWHLD 123 Query: 260 VGSSHPGAGEGPKGSAVRRLKWYASWVQNVVRQFGPY 150 VGSSHPGA GPKG AVR LK YASWVQNVVRQFGPY Sbjct: 124 VGSSHPGAVAGPKGWAVRPLKRYASWVQNVVRQFGPY 160 >emb|SCI72369.1| Uncharacterised protein [uncultured Clostridium sp.] emb|SCH31575.1| Uncharacterised protein [uncultured Clostridium sp.] Length = 166 Score = 192 bits (489), Expect = 4e-58 Identities = 106/157 (67%), Positives = 109/157 (69%), Gaps = 4/157 (2%) Frame = -1 Query: 608 PAVVERSLKYQPSLI*SLTPCGE----QCLVGSLTGAVAS*SVTEAFKGMLSTVGNRTWS 441 P E L Y P I LT C + QCL GSLTGAVAS V+EA KG L VGN S Sbjct: 3 PVAAEPMLGYHPCSIGFLTSCRDPAVGQCLAGSLTGAVASERVSEALKGSLRMVGNHPKS 62 Query: 440 AIVQACLTVRPTGRAGAKAGYSDPVVLHGRAIAQRIKGTLGITG*SPPRVHIDGEVWHLD 261 A + LT PTG AG K G SDPVVL G AIAQRIK TLGITG S PRVHIDG VWHLD Sbjct: 63 AKAEGSLTATPTGGAGTKVGLSDPVVLSGNAIAQRIKATLGITGLSLPRVHIDGVVWHLD 122 Query: 260 VGSSHPGAGEGPKGSAVRRLKWYASWVQNVVRQFGPY 150 VGSSHPGA GPKG AVR LK YASWVQNVVRQFGPY Sbjct: 123 VGSSHPGAVAGPKGWAVRPLKRYASWVQNVVRQFGPY 159