BLASTX nr result
ID: Cheilocostus21_contig00017430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017430 (950 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413438.1| PREDICTED: F-box protein SKIP14-like [Musa a... 64 1e-07 >ref|XP_009413438.1| PREDICTED: F-box protein SKIP14-like [Musa acuminata subsp. malaccensis] Length = 415 Score = 63.9 bits (154), Expect = 1e-07 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = +2 Query: 779 MALNFPSCSTFSNSIVPTDDEPFRSRYEGSQSFGYPFLSGWDAGNSYGYTGG 934 MALNF SCS FS + V TDDE R R E SQ F YPF SGW+ GN YG+ G Sbjct: 1 MALNFSSCSIFSTAFV-TDDEFCRPRCERSQPFSYPFSSGWENGNGYGWDSG 51