BLASTX nr result
ID: Cheilocostus21_contig00017270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017270 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400502.1| PREDICTED: AP2/ERF and B3 domain-containing ... 58 7e-07 ref|XP_010926493.1| PREDICTED: AP2/ERF and B3 domain-containing ... 55 4e-06 >ref|XP_009400502.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like [Musa acuminata subsp. malaccensis] Length = 363 Score = 57.8 bits (138), Expect = 7e-07 Identities = 38/78 (48%), Positives = 48/78 (61%), Gaps = 14/78 (17%) Frame = -1 Query: 444 PEKQLVIAW--------SSGGFSSPRPAVEVLRLFGVNIVKAPAPAGGDVT----VG-NK 304 PEKQL I W ++ G + +P VEV+RLFGVNIVK PA GDV+ VG Sbjct: 280 PEKQLFIGWKTRTAGAHTADGVQATKPPVEVVRLFGVNIVKIPAAVSGDVSDRSGVGWAA 339 Query: 303 KRSRE-ELLPSQELLKKQ 253 KR+R+ +L+ S EL KKQ Sbjct: 340 KRTRDMDLISSLELFKKQ 357 >ref|XP_010926493.1| PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like [Elaeis guineensis] Length = 338 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = -1 Query: 444 PEKQLVIAWSSGGFSSPRPAVEVLRLFGVNIVKAPAPAGGDVTVGNK-KRSRE-ELLPSQ 271 PEKQL I W+ G ++ A +V+RLFGVNI++ P GG G + KR RE EL P + Sbjct: 268 PEKQLYIDWNPRGVAADLIAPQVVRLFGVNILRTPVGCGGCPGGGGEGKRGREMELFPPE 327 Query: 270 ELLKKQF 250 + +KKQ+ Sbjct: 328 QFVKKQY 334