BLASTX nr result
ID: Cheilocostus21_contig00017261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017261 (1729 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007761644.1| reverse transcriptase [Rose yellow vein viru... 84 5e-13 >ref|YP_007761644.1| reverse transcriptase [Rose yellow vein virus] gb|AFO54491.1| reverse transcriptase [Rose yellow vein virus] Length = 819 Score = 83.6 bits (205), Expect = 5e-13 Identities = 45/93 (48%), Positives = 63/93 (67%) Frame = +3 Query: 3 GV*SDSQQK*STFDKVLRSIVKALKKFRIFLFKPFELMCDNTAVVGFLHKDNIDETRSAK 182 G + ++Q STF K LR+I AL+KF++FLF+PF L DN AV+ FL KD ++E RS + Sbjct: 724 GTWNQTEQNWSTFGKELRAIKLALQKFKLFLFEPFTLYSDNLAVINFLKKD-LNEKRSQR 782 Query: 183 QLHNKQSINSYLDRMKITYISGTKNFLADALSR 281 ++ +K I Y M + +I GTKN LADAL+R Sbjct: 783 EIRDKLDILQYQGWMTLKHIPGTKNVLADALTR 815