BLASTX nr result
ID: Cheilocostus21_contig00017234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00017234 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009411672.1| PREDICTED: UDP-glucuronic acid decarboxylase... 67 4e-10 ref|XP_009387911.2| PREDICTED: UDP-glucuronic acid decarboxylase... 63 2e-09 ref|XP_009382533.1| PREDICTED: UDP-glucuronic acid decarboxylase... 65 3e-09 ref|XP_009417727.1| PREDICTED: UDP-glucuronic acid decarboxylase... 62 2e-08 gb|AMM04375.1| UDP-xylose synthase [Ornithogalum longebracteatum] 59 4e-07 gb|OAY65168.1| UDP-glucuronic acid decarboxylase 2 [Ananas comosus] 58 7e-07 ref|XP_020087094.1| UDP-glucuronic acid decarboxylase 2-like [An... 58 7e-07 ref|XP_009414893.1| PREDICTED: UDP-glucuronic acid decarboxylase... 57 1e-06 ref|XP_020108499.1| UDP-glucuronic acid decarboxylase 2-like [An... 57 1e-06 ref|XP_004152248.1| PREDICTED: UDP-glucuronic acid decarboxylase... 57 1e-06 gb|PKA58425.1| UDP-glucuronic acid decarboxylase 2 [Apostasia sh... 57 1e-06 ref|XP_020273935.1| UDP-glucuronic acid decarboxylase 4-like [As... 55 2e-06 ref|XP_008454336.1| PREDICTED: UDP-glucuronic acid decarboxylase... 57 2e-06 gb|OTG06250.1| putative NAD(P)-binding domain-containing protein... 56 2e-06 gb|PHU16480.1| UDP-glucuronic acid decarboxylase 2 [Capsicum chi... 53 2e-06 gb|OAY63899.1| UDP-glucuronic acid decarboxylase 2 [Ananas comosus] 56 2e-06 gb|ACF86406.1| unknown [Zea mays] 55 2e-06 ref|XP_020701263.1| UDP-glucuronic acid decarboxylase 2 [Dendrob... 56 2e-06 gb|AQK85253.1| UDP-glucuronic acid decarboxylase 4 [Zea mays] 55 2e-06 gb|AQK93048.1| UDP-glucuronic acid decarboxylase 4 [Zea mays] >g... 55 3e-06 >ref|XP_009411672.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata subsp. malaccensis] Length = 446 Score = 67.0 bits (162), Expect = 4e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDANP 351 WEPKIPLR+GLPLMVSDF KRIFGDHSDANP Sbjct: 404 WEPKIPLRQGLPLMVSDFRKRIFGDHSDANP 434 >ref|XP_009387911.2| PREDICTED: UDP-glucuronic acid decarboxylase 4 [Musa acuminata subsp. malaccensis] Length = 197 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDANP 351 WEPKIPLR+GLPLMVSDF KRIFGDH D NP Sbjct: 153 WEPKIPLRQGLPLMVSDFRKRIFGDHFDVNP 183 >ref|XP_009382533.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Musa acuminata subsp. malaccensis] ref|XP_018676372.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Musa acuminata subsp. malaccensis] Length = 449 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDANP 351 WEPKIPLR+GLPLMVSDF KRIFGDHSDA P Sbjct: 407 WEPKIPLRQGLPLMVSDFHKRIFGDHSDAKP 437 >ref|XP_009417727.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata subsp. malaccensis] Length = 439 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDANP 351 WEPKI LR+GLPLMVSDF RIFGDHSDANP Sbjct: 400 WEPKISLRQGLPLMVSDFRNRIFGDHSDANP 430 >gb|AMM04375.1| UDP-xylose synthase [Ornithogalum longebracteatum] Length = 433 Score = 58.5 bits (140), Expect = 4e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDAN 354 WEPKIPLR+GLPLMVSDF KRIFGDHS + Sbjct: 399 WEPKIPLRQGLPLMVSDFRKRIFGDHSSTD 428 >gb|OAY65168.1| UDP-glucuronic acid decarboxylase 2 [Ananas comosus] Length = 436 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDAN 354 WEPKIPLREGLPLMVSDF RIFGDHS ++ Sbjct: 396 WEPKIPLREGLPLMVSDFRNRIFGDHSTSS 425 >ref|XP_020087094.1| UDP-glucuronic acid decarboxylase 2-like [Ananas comosus] Length = 441 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDAN 354 WEPKIPLREGLPLMVSDF RIFGDHS ++ Sbjct: 401 WEPKIPLREGLPLMVSDFRNRIFGDHSTSS 430 >ref|XP_009414893.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata subsp. malaccensis] Length = 443 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDAN 354 WEPKI LREGLPLMVSDF KRIFGDHS+ + Sbjct: 399 WEPKISLREGLPLMVSDFRKRIFGDHSEVD 428 >ref|XP_020108499.1| UDP-glucuronic acid decarboxylase 2-like [Ananas comosus] Length = 452 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDA 357 WEPKI LR+GLPLMVSDF KR+FGDH+DA Sbjct: 411 WEPKISLRQGLPLMVSDFRKRVFGDHTDA 439 >ref|XP_004152248.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Cucumis sativus] gb|KGN52813.1| hypothetical protein Csa_4G001800 [Cucumis sativus] Length = 435 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSD 360 WEPKIPLR+GLPLMVSDF +RIFGDH D Sbjct: 400 WEPKIPLRKGLPLMVSDFRQRIFGDHKD 427 >gb|PKA58425.1| UDP-glucuronic acid decarboxylase 2 [Apostasia shenzhenica] Length = 452 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDA 357 WEPKIPLR+GLPLMVSDF KRIFGDH A Sbjct: 408 WEPKIPLRKGLPLMVSDFRKRIFGDHDAA 436 >ref|XP_020273935.1| UDP-glucuronic acid decarboxylase 4-like [Asparagus officinalis] gb|ONK62923.1| uncharacterized protein A4U43_C07F9520 [Asparagus officinalis] Length = 166 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDAN 354 WEPKI LR+GLPLMVSDF KRIFGDHS + Sbjct: 132 WEPKISLRKGLPLMVSDFRKRIFGDHSSTD 161 >ref|XP_008454336.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Cucumis melo] Length = 435 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSD 360 WEPK+PLR+GLPLMVSDF +RIFGDH D Sbjct: 400 WEPKVPLRKGLPLMVSDFRQRIFGDHKD 427 >gb|OTG06250.1| putative NAD(P)-binding domain-containing protein [Helianthus annuus] Length = 226 Score = 55.8 bits (133), Expect = 2e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSD 360 WEPK+PLR+GLP+MVSDF +RIFGDH D Sbjct: 189 WEPKVPLRKGLPMMVSDFRQRIFGDHKD 216 >gb|PHU16480.1| UDP-glucuronic acid decarboxylase 2 [Capsicum chinense] Length = 79 Score = 52.8 bits (125), Expect = 2e-06 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSD 360 WEPK+PLR+GLP+MV DF +RIFGDH + Sbjct: 44 WEPKVPLRKGLPMMVQDFRQRIFGDHKE 71 >gb|OAY63899.1| UDP-glucuronic acid decarboxylase 2 [Ananas comosus] Length = 343 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDA 357 WEPKI LR+GLPLMVSDF KR+FGDH+D+ Sbjct: 302 WEPKISLRQGLPLMVSDFRKRVFGDHTDS 330 >gb|ACF86406.1| unknown [Zea mays] Length = 169 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDA 357 WEPKIPLREGLPLMV+DF KRIFGD A Sbjct: 132 WEPKIPLREGLPLMVTDFRKRIFGDQDTA 160 >ref|XP_020701263.1| UDP-glucuronic acid decarboxylase 2 [Dendrobium catenatum] gb|PKU74100.1| UDP-glucuronic acid decarboxylase 2 [Dendrobium catenatum] Length = 440 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHS 363 WEPK+PLR+GLPLMVSDF KRIFGDH+ Sbjct: 398 WEPKVPLRKGLPLMVSDFRKRIFGDHA 424 >gb|AQK85253.1| UDP-glucuronic acid decarboxylase 4 [Zea mays] Length = 226 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDA 357 WEPKIPLREGLPLMVSDF KRIFGD A Sbjct: 189 WEPKIPLREGLPLMVSDFRKRIFGDQDAA 217 >gb|AQK93048.1| UDP-glucuronic acid decarboxylase 4 [Zea mays] gb|AQK93050.1| UDP-glucuronic acid decarboxylase 4 [Zea mays] Length = 188 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 443 WEPKIPLREGLPLMVSDFSKRIFGDHSDA 357 WEPKIPLREGLPLMV+DF KRIFGD A Sbjct: 151 WEPKIPLREGLPLMVTDFRKRIFGDQDTA 179