BLASTX nr result
ID: Cheilocostus21_contig00016786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00016786 (652 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409138.1| PREDICTED: uncharacterized protein LOC103991... 76 1e-14 >ref|XP_009409138.1| PREDICTED: uncharacterized protein LOC103991411 [Musa acuminata subsp. malaccensis] Length = 78 Score = 75.9 bits (185), Expect = 1e-14 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 5/57 (8%) Frame = +2 Query: 203 QGHGRDTPKRGL-SDTESGLWSAREMMEVVMDYKEPGANTNPRAGV----PPSPAKP 358 +GHGR RGL S+TE+GLW+ R+M E VMDYKEPGANTNPR+GV PPSP +P Sbjct: 22 EGHGRKLIMRGLLSETENGLWTGRDMEETVMDYKEPGANTNPRSGVFFSTPPSPPRP 78