BLASTX nr result
ID: Cheilocostus21_contig00016578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00016578 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009410546.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 112 3e-25 ref|XP_009381379.1| PREDICTED: F-box/LRR-repeat protein 3-like i... 112 4e-25 ref|XP_009381378.1| PREDICTED: F-box/LRR-repeat protein 3-like i... 112 4e-25 ref|XP_020101948.1| F-box/LRR-repeat protein 3-like [Ananas como... 97 7e-20 gb|OAY62570.1| F-box/LRR-repeat protein 3 [Ananas comosus] 97 7e-20 ref|XP_019106269.1| PREDICTED: F-box/LRR-repeat protein 3 [Beta ... 94 6e-19 gb|KMT06633.1| hypothetical protein BVRB_7g158000 isoform B [Bet... 94 6e-19 ref|XP_021731202.1| F-box/LRR-repeat protein 3-like [Chenopodium... 92 4e-18 gb|KNA20076.1| hypothetical protein SOVF_055650 isoform A [Spina... 92 4e-18 ref|XP_021861299.1| F-box/LRR-repeat protein 3 [Spinacia oleracea] 92 4e-18 gb|KNA20077.1| hypothetical protein SOVF_055650 isoform B [Spina... 92 4e-18 ref|XP_021765967.1| F-box/LRR-repeat protein 3-like [Chenopodium... 91 7e-18 ref|XP_018853515.1| PREDICTED: F-box/LRR-repeat protein 3-like, ... 83 2e-17 gb|OAY67523.1| F-box/LRR-repeat protein 3, partial [Ananas comosus] 89 5e-17 gb|POE55916.1| f-box/lrr-repeat protein 3 [Quercus suber] >gi|13... 87 1e-16 ref|XP_023896462.1| F-box/LRR-repeat protein 3-like [Quercus sub... 87 2e-16 ref|XP_017181610.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 87 2e-16 ref|XP_008384720.1| PREDICTED: F-box/LRR-repeat protein 3-like [... 87 3e-16 gb|PIM97422.1| hypothetical protein CDL12_30108 [Handroanthus im... 80 4e-16 gb|KDO36184.1| hypothetical protein CISIN_1g034993mg [Citrus sin... 79 4e-16 >ref|XP_009410546.1| PREDICTED: F-box/LRR-repeat protein 3-like [Musa acuminata subsp. malaccensis] Length = 716 Score = 112 bits (280), Expect = 3e-25 Identities = 50/66 (75%), Positives = 60/66 (90%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H+SFKPL+PK +++HIEARGCVFQWR+KPFQVELE SE+WK+ Sbjct: 651 LAAALLACGGLTKVKLHSSFKPLVPKPLLKHIEARGCVFQWRDKPFQVELEPSEVWKQHS 710 Query: 403 QEMHVQ 386 QEMHV+ Sbjct: 711 QEMHVE 716 >ref|XP_009381379.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 714 Score = 112 bits (279), Expect = 4e-25 Identities = 50/65 (76%), Positives = 59/65 (90%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L A L+A GGLTKVK+H+SFKPLIPK I+EH+EARGC+FQWR+KPFQVELE SE+WK+Q Sbjct: 650 LAAVLVACGGLTKVKLHSSFKPLIPKPILEHVEARGCLFQWRDKPFQVELEPSEVWKQQS 709 Query: 403 QEMHV 389 QEMHV Sbjct: 710 QEMHV 714 >ref|XP_009381378.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 715 Score = 112 bits (279), Expect = 4e-25 Identities = 50/65 (76%), Positives = 59/65 (90%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L A L+A GGLTKVK+H+SFKPLIPK I+EH+EARGC+FQWR+KPFQVELE SE+WK+Q Sbjct: 651 LAAVLVACGGLTKVKLHSSFKPLIPKPILEHVEARGCLFQWRDKPFQVELEPSEVWKQQS 710 Query: 403 QEMHV 389 QEMHV Sbjct: 711 QEMHV 715 >ref|XP_020101948.1| F-box/LRR-repeat protein 3-like [Ananas comosus] Length = 697 Score = 97.1 bits (240), Expect = 7e-20 Identities = 44/66 (66%), Positives = 58/66 (87%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H+SFK LI K +++HIEARGC FQW +KPFQV+LE++E+WK+QL Sbjct: 632 LAAALLACGGLTKVKLHSSFKSLISKPLLQHIEARGCSFQWISKPFQVQLETNEVWKQQL 691 Query: 403 QEMHVQ 386 Q++ V+ Sbjct: 692 QDVVVR 697 >gb|OAY62570.1| F-box/LRR-repeat protein 3 [Ananas comosus] Length = 697 Score = 97.1 bits (240), Expect = 7e-20 Identities = 44/66 (66%), Positives = 58/66 (87%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H+SFK LI K +++HIEARGC FQW +KPFQV+LE++E+WK+QL Sbjct: 632 LAAALLACGGLTKVKLHSSFKSLISKPLLQHIEARGCSFQWISKPFQVQLETNEVWKQQL 691 Query: 403 QEMHVQ 386 Q++ V+ Sbjct: 692 QDVVVR 697 >ref|XP_019106269.1| PREDICTED: F-box/LRR-repeat protein 3 [Beta vulgaris subsp. vulgaris] gb|KMT06632.1| hypothetical protein BVRB_7g158000 isoform A [Beta vulgaris subsp. vulgaris] Length = 669 Score = 94.4 bits (233), Expect = 6e-19 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H+SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK QL Sbjct: 603 LAAALLACGGLTKVKLHSSFKSLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQL 662 Query: 403 QEMH 392 EM+ Sbjct: 663 AEMN 666 >gb|KMT06633.1| hypothetical protein BVRB_7g158000 isoform B [Beta vulgaris subsp. vulgaris] Length = 681 Score = 94.4 bits (233), Expect = 6e-19 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H+SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK QL Sbjct: 615 LAAALLACGGLTKVKLHSSFKSLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQL 674 Query: 403 QEMH 392 EM+ Sbjct: 675 AEMN 678 >ref|XP_021731202.1| F-box/LRR-repeat protein 3-like [Chenopodium quinoa] Length = 674 Score = 92.0 bits (227), Expect = 4e-18 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H+SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK Q+ Sbjct: 608 LAAALLACGGLTKVKLHSSFKTLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQV 667 Query: 403 QEMH 392 E++ Sbjct: 668 AELN 671 >gb|KNA20076.1| hypothetical protein SOVF_055650 isoform A [Spinacia oleracea] Length = 677 Score = 92.0 bits (227), Expect = 4e-18 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L +ALLA GGLTKVK+H+SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK Q+ Sbjct: 611 LASALLACGGLTKVKLHSSFKTLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQV 670 Query: 403 QEMH 392 EM+ Sbjct: 671 AEMN 674 >ref|XP_021861299.1| F-box/LRR-repeat protein 3 [Spinacia oleracea] Length = 685 Score = 92.0 bits (227), Expect = 4e-18 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L +ALLA GGLTKVK+H+SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK Q+ Sbjct: 619 LASALLACGGLTKVKLHSSFKTLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQV 678 Query: 403 QEMH 392 EM+ Sbjct: 679 AEMN 682 >gb|KNA20077.1| hypothetical protein SOVF_055650 isoform B [Spinacia oleracea] Length = 690 Score = 92.0 bits (227), Expect = 4e-18 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L +ALLA GGLTKVK+H+SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK Q+ Sbjct: 624 LASALLACGGLTKVKLHSSFKTLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQV 683 Query: 403 QEMH 392 EM+ Sbjct: 684 AEMN 687 >ref|XP_021765967.1| F-box/LRR-repeat protein 3-like [Chenopodium quinoa] Length = 674 Score = 91.3 bits (225), Expect = 7e-18 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H SFK L+P+ + EH+EARGCVFQWR K FQ ELE S+ WK Q+ Sbjct: 608 LAAALLACGGLTKVKLHLSFKTLLPQPLFEHLEARGCVFQWREKMFQDELEDSKSWKLQV 667 Query: 403 QEMH 392 E++ Sbjct: 668 AELN 671 >ref|XP_018853515.1| PREDICTED: F-box/LRR-repeat protein 3-like, partial [Juglans regia] Length = 101 Score = 83.2 bits (204), Expect = 2e-17 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H SFK ++P+ + EH+EARGC F WRNK F+ EL+ + WK +L Sbjct: 38 LAAALLACGGLTKVKLHASFKSMLPQQLFEHLEARGCAFHWRNKVFEAELD-PQCWKLRL 96 Query: 403 QEM 395 ++M Sbjct: 97 EDM 99 >gb|OAY67523.1| F-box/LRR-repeat protein 3, partial [Ananas comosus] Length = 711 Score = 89.0 bits (219), Expect = 5e-17 Identities = 38/62 (61%), Positives = 53/62 (85%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 LVAALL+ G LTKVK+H+SFK L+ + ++EHIEARGC+ QW +KPFQ+E+E +E+WK+Q Sbjct: 650 LVAALLSCGSLTKVKLHSSFKSLVSQPLLEHIEARGCLLQWVDKPFQIEMEPNEVWKQQS 709 Query: 403 QE 398 Q+ Sbjct: 710 QD 711 >gb|POE55916.1| f-box/lrr-repeat protein 3 [Quercus suber] gb|POE96309.1| f-box/lrr-repeat protein 3 [Quercus suber] Length = 561 Score = 87.4 bits (215), Expect = 1e-16 Identities = 40/63 (63%), Positives = 51/63 (80%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H SFK L+P+ I EH+EARGC+FQWR K F+ EL+ + WK+QL Sbjct: 498 LAAALLACGGLTKVKLHASFKSLLPQAIFEHLEARGCLFQWREKVFKAELD-PKCWKRQL 556 Query: 403 QEM 395 ++M Sbjct: 557 EDM 559 >ref|XP_023896462.1| F-box/LRR-repeat protein 3-like [Quercus suber] ref|XP_023923886.1| F-box/LRR-repeat protein 3-like [Quercus suber] Length = 683 Score = 87.4 bits (215), Expect = 2e-16 Identities = 40/63 (63%), Positives = 51/63 (80%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+H SFK L+P+ I EH+EARGC+FQWR K F+ EL+ + WK+QL Sbjct: 620 LAAALLACGGLTKVKLHASFKSLLPQAIFEHLEARGCLFQWREKVFKAELD-PKCWKRQL 678 Query: 403 QEM 395 ++M Sbjct: 679 EDM 681 >ref|XP_017181610.1| PREDICTED: F-box/LRR-repeat protein 3-like [Malus domestica] Length = 481 Score = 86.7 bits (213), Expect = 2e-16 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELE 431 L AALLA GGLTKVK+HTSFKPL+PK I EH+E RGCVF WRNK FQVE++ Sbjct: 419 LAAALLACGGLTKVKLHTSFKPLLPKYIFEHMEGRGCVFHWRNKAFQVEID 469 >ref|XP_008384720.1| PREDICTED: F-box/LRR-repeat protein 3-like [Malus domestica] Length = 664 Score = 86.7 bits (213), Expect = 3e-16 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELE 431 L AALLA GGLTKVK+HTSFKPL+PK I EH+E RGCVF WRNK FQVE++ Sbjct: 602 LAAALLACGGLTKVKLHTSFKPLLPKYIFEHMEGRGCVFHWRNKAFQVEID 652 >gb|PIM97422.1| hypothetical protein CDL12_30108 [Handroanthus impetiginosus] Length = 102 Score = 80.1 bits (196), Expect = 4e-16 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GGLTKVK+ TSFK L+P+ + H+EARGC FQWR+K FQ EL+S WK QL Sbjct: 40 LAAALLACGGLTKVKLQTSFKSLLPECLFGHLEARGCSFQWRDKIFQAELDSKS-WKLQL 98 Query: 403 QE 398 + Sbjct: 99 AD 100 >gb|KDO36184.1| hypothetical protein CISIN_1g034993mg [Citrus sinensis] Length = 77 Score = 79.3 bits (194), Expect = 4e-16 Identities = 36/62 (58%), Positives = 48/62 (77%) Frame = -2 Query: 583 LVAALLAYGGLTKVKIHTSFKPLIPKTIIEHIEARGCVFQWRNKPFQVELESSELWKKQL 404 L AALLA GG+TKVK+ +FK L+P+ +I+H++ARGCVFQWRNK FQ EL+ WK L Sbjct: 14 LAAALLACGGITKVKLQAAFKQLLPQPLIDHLQARGCVFQWRNKVFQAELDPKS-WKLLL 72 Query: 403 QE 398 ++ Sbjct: 73 ED 74