BLASTX nr result
ID: Cheilocostus21_contig00016559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00016559 (702 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV32632.1| putative LRR receptor-like serine/threonine-prote... 56 8e-06 >gb|KZV32632.1| putative LRR receptor-like serine/threonine-protein kinase [Dorcoceras hygrometricum] Length = 213 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/42 (50%), Positives = 36/42 (85%) Frame = +1 Query: 148 IVDRKLMSLNKIHTDKNPSDMMTKIVTKEKTEVCKKMAGLVI 273 ++DR+L+ L KIHT +NP+DM+TK+VT+EK E+C+ + G+++ Sbjct: 168 VMDRQLLRLVKIHTKENPADMLTKVVTREKLELCRDIVGMLV 209