BLASTX nr result
ID: Cheilocostus21_contig00016100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00016100 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014498074.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... 63 1e-08 ref|XP_009406681.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 62 1e-08 gb|PIN14100.1| Beta-ketoacyl-[acyl-carrier-protein] synthase III... 62 1e-08 ref|XP_011079297.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... 62 1e-08 gb|AAC04694.1| beta-ketoacyl-ACP synthase IIIB [Perilla frutescens] 62 1e-08 ref|XP_010937106.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 62 2e-08 ref|XP_006597100.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 59 3e-08 ref|XP_019073753.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 3e-08 gb|PHT87717.1| hypothetical protein T459_09823 [Capsicum annuum] 57 3e-08 ref|XP_007140132.1| hypothetical protein PHAVU_008G086600g [Phas... 61 3e-08 ref|XP_003631438.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 3e-08 emb|CBI25782.3| unnamed protein product, partial [Vitis vinifera] 61 4e-08 ref|XP_019165760.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 5e-08 ref|XP_019165759.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 5e-08 ref|XP_017418765.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 5e-08 ref|XP_020239285.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... 61 5e-08 ref|NP_001237735.1| beta-ketoacyl-acyl carrier protein synthase ... 61 5e-08 ref|XP_019165758.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 5e-08 gb|KZV34323.1| 3-oxoacyl [Dorcoceras hygrometricum] 61 5e-08 ref|XP_018848180.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 61 5e-08 >ref|XP_014498074.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic [Vigna radiata var. radiata] Length = 392 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQAG TIATAGFGAGLTWGSAIVRW Sbjct: 362 VRSGKVQAGQTIATAGFGAGLTWGSAIVRW 391 >ref|XP_009406681.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase 3 B, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 397 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRWR 328 +R GK+QAG+TIATAGFGAGLTWGSAI+RWR Sbjct: 367 IRGGKIQAGNTIATAGFGAGLTWGSAIIRWR 397 >gb|PIN14100.1| Beta-ketoacyl-[acyl-carrier-protein] synthase III [Handroanthus impetiginosus] Length = 400 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQAG TIATAGFGAGLTWGSAIVRW Sbjct: 370 VRSGKVQAGHTIATAGFGAGLTWGSAIVRW 399 >ref|XP_011079297.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic [Sesamum indicum] Length = 400 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQAG TIATAGFGAGLTWGSAIVRW Sbjct: 370 VRSGKVQAGHTIATAGFGAGLTWGSAIVRW 399 >gb|AAC04694.1| beta-ketoacyl-ACP synthase IIIB [Perilla frutescens] Length = 400 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQAG TIATAGFGAGLTWGSAIVRW Sbjct: 370 VRSGKVQAGHTIATAGFGAGLTWGSAIVRW 399 >ref|XP_010937106.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic [Elaeis guineensis] Length = 409 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRWR 328 VRSGKVQAG+TIA AGFGAGLTWGSAIVRW+ Sbjct: 379 VRSGKVQAGNTIAAAGFGAGLTWGSAIVRWK 409 >ref|XP_006597100.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic-like isoform X2 [Glycine max] Length = 157 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKV+ G TIATAGFGAGLTWGSAIVRW Sbjct: 127 VRSGKVKPGQTIATAGFGAGLTWGSAIVRW 156 >ref|XP_019073753.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic-like, partial [Vitis vinifera] Length = 376 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQ+G TIATAGFGAGLTWGSAIVRW Sbjct: 346 VRSGKVQSGHTIATAGFGAGLTWGSAIVRW 375 >gb|PHT87717.1| hypothetical protein T459_09823 [Capsicum annuum] Length = 84 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQAG IA AGFGAGLTWGSAI+RW Sbjct: 54 VRSGKVQAGHVIAAAGFGAGLTWGSAILRW 83 >ref|XP_007140132.1| hypothetical protein PHAVU_008G086600g [Phaseolus vulgaris] gb|ESW12126.1| hypothetical protein PHAVU_008G086600g [Phaseolus vulgaris] Length = 392 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKV+AG TIATAGFGAGLTWGSAIVRW Sbjct: 362 VRSGKVKAGQTIATAGFGAGLTWGSAIVRW 391 >ref|XP_003631438.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic [Vitis vinifera] emb|CBI31890.3| unnamed protein product, partial [Vitis vinifera] Length = 400 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQ+G TIATAGFGAGLTWGSAIVRW Sbjct: 370 VRSGKVQSGHTIATAGFGAGLTWGSAIVRW 399 >emb|CBI25782.3| unnamed protein product, partial [Vitis vinifera] Length = 434 Score = 61.2 bits (147), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKVQ+G TIATAGFGAGLTWGSAIVRW Sbjct: 404 VRSGKVQSGHTIATAGFGAGLTWGSAIVRW 433 >ref|XP_019165760.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic-like isoform X3 [Ipomoea nil] Length = 364 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRWR 328 VR+GK+QAG TIA AGFGAGLTWGSAI+RWR Sbjct: 334 VRAGKIQAGETIAAAGFGAGLTWGSAIIRWR 364 >ref|XP_019165759.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic-like isoform X2 [Ipomoea nil] Length = 373 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRWR 328 VR+GK+QAG TIA AGFGAGLTWGSAI+RWR Sbjct: 343 VRAGKIQAGETIAAAGFGAGLTWGSAIIRWR 373 >ref|XP_017418765.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic [Vigna angularis] gb|KOM37330.1| hypothetical protein LR48_Vigan03g071100 [Vigna angularis] dbj|BAT83936.1| hypothetical protein VIGAN_04118000 [Vigna angularis var. angularis] Length = 392 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKV+AG TIATAGFGAGLTWGSAIVRW Sbjct: 362 VRSGKVKAGHTIATAGFGAGLTWGSAIVRW 391 >ref|XP_020239285.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic-like [Cajanus cajan] gb|KYP42674.1| hypothetical protein KK1_035917 [Cajanus cajan] Length = 395 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGK++AG TIATAGFGAGLTWGSAIVRW Sbjct: 365 VRSGKIKAGQTIATAGFGAGLTWGSAIVRW 394 >ref|NP_001237735.1| beta-ketoacyl-acyl carrier protein synthase III [Glycine max] gb|AAF70509.1| beta-ketoacyl-acyl carrier protein synthase III [Glycine max] gb|KRH00403.1| hypothetical protein GLYMA_18G211400 [Glycine max] Length = 397 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKV+AG TIATAGFGAGLTWGSAI+RW Sbjct: 367 VRSGKVKAGQTIATAGFGAGLTWGSAIIRW 396 >ref|XP_019165758.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic-like isoform X1 [Ipomoea nil] Length = 399 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRWR 328 VR+GK+QAG TIA AGFGAGLTWGSAI+RWR Sbjct: 369 VRAGKIQAGETIAAAGFGAGLTWGSAIIRWR 399 >gb|KZV34323.1| 3-oxoacyl [Dorcoceras hygrometricum] Length = 400 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKV+AG TIATAGFGAGLTWGSAIVRW Sbjct: 370 VRSGKVKAGHTIATAGFGAGLTWGSAIVRW 399 >ref|XP_018848180.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic-like [Juglans regia] Length = 404 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 420 VRSGKVQAGSTIATAGFGAGLTWGSAIVRW 331 VRSGKV+AG TIATAGFGAGLTWGSAIVRW Sbjct: 374 VRSGKVKAGHTIATAGFGAGLTWGSAIVRW 403