BLASTX nr result
ID: Cheilocostus21_contig00016088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00016088 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009385589.1| PREDICTED: serine/threonine-protein phosphat... 67 2e-09 >ref|XP_009385589.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3 [Musa acuminata subsp. malaccensis] Length = 815 Score = 66.6 bits (161), Expect = 2e-09 Identities = 38/61 (62%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = -2 Query: 544 ESAVSLFEEDAEFVGVDLAVSRGTNGEVDATKRNFVLSVSEPPEAREGGT-MLEFSKSHW 368 E+ LFEEDAEFVGVD+ V R NGEV A KRN V V E P+ E T LEFSKSHW Sbjct: 746 ETTPCLFEEDAEFVGVDIEVRRAMNGEVGAIKRNLV-KVPELPKPHEDETARLEFSKSHW 804 Query: 367 R 365 R Sbjct: 805 R 805