BLASTX nr result
ID: Cheilocostus21_contig00016004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00016004 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381510.1| PREDICTED: fructokinase-1 [Musa acuminata su... 59 5e-07 >ref|XP_009381510.1| PREDICTED: fructokinase-1 [Musa acuminata subsp. malaccensis] Length = 470 Score = 58.9 bits (141), Expect = 5e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 506 TKGPMNGYNDRLVRIPISNVVFELLPKFDTACERSTMWS 390 +K +NG NDRLVRIPISNVVFELLPKFD ACE S S Sbjct: 432 SKVTINGCNDRLVRIPISNVVFELLPKFDAACESSVTQS 470