BLASTX nr result
ID: Cheilocostus21_contig00015880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00015880 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400026.1| PREDICTED: signal peptide peptidase 2 [Musa ... 56 3e-06 >ref|XP_009400026.1| PREDICTED: signal peptide peptidase 2 [Musa acuminata subsp. malaccensis] ref|XP_009400027.1| PREDICTED: signal peptide peptidase 2 [Musa acuminata subsp. malaccensis] Length = 346 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 483 AAHCLWNGEIKPLLEFDESKSSDDPSTGATQ 391 AAHCLWNGE+KPLLE+DESK S +PS+ +TQ Sbjct: 305 AAHCLWNGEVKPLLEYDESKLSTEPSSSSTQ 335