BLASTX nr result
ID: Cheilocostus21_contig00015579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00015579 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412232.1| PREDICTED: BTB/POZ domain and ankyrin repeat... 104 6e-23 ref|XP_018678587.1| PREDICTED: BTB/POZ domain and ankyrin repeat... 103 1e-22 ref|XP_009392990.1| PREDICTED: BTB/POZ domain and ankyrin repeat... 103 1e-22 gb|AHF20182.1| non-expressor of pr1, partial [Musa acuminata AAA... 99 5e-21 ref|XP_009385599.1| PREDICTED: BTB/POZ domain and ankyrin repeat... 94 2e-19 ref|XP_010924980.1| PREDICTED: BTB/POZ domain and ankyrin repeat... 76 4e-13 ref|XP_008807141.1| PREDICTED: regulatory protein NPR1-like isof... 75 8e-13 ref|XP_002455011.1| BTB/POZ domain and ankyrin repeat-containing... 62 5e-08 ref|XP_006386278.1| hypothetical protein POPTR_0002s05750g [Popu... 59 6e-08 ref|XP_020097395.1| BTB/POZ domain and ankyrin repeat-containing... 60 2e-07 gb|OAY83040.1| Regulatory protein NPR1 [Ananas comosus] 60 2e-07 ref|XP_007048936.2| PREDICTED: regulatory protein NPR3 [Theobrom... 59 4e-07 gb|EOX93093.1| NPR1-like protein 3, putative [Theobroma cacao] 59 4e-07 gb|ADP68616.1| NPR disease resistance protein, partial [Setaria ... 59 5e-07 ref|XP_004968514.1| BTB/POZ domain and ankyrin repeat-containing... 59 6e-07 ref|XP_020183881.1| BTB/POZ domain and ankyrin repeat-containing... 59 6e-07 ref|XP_021301180.1| BTB/POZ domain and ankyrin repeat-containing... 59 6e-07 gb|AKH61408.1| nonexpressor of pathogenesis-related protein 1-li... 59 6e-07 ref|XP_006645596.1| PREDICTED: regulatory protein NPR1 [Oryza br... 58 8e-07 ref|XP_017609711.1| PREDICTED: regulatory protein NPR3-like [Gos... 58 8e-07 >ref|XP_009412232.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Musa acuminata subsp. malaccensis] Length = 581 Score = 104 bits (259), Expect = 6e-23 Identities = 55/92 (59%), Positives = 67/92 (72%), Gaps = 5/92 (5%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV+LGM FFPRCSKVIDKFLGDD +VE +NTEERKNRYNEIL E +AF +D Sbjct: 490 ALTKTVQLGMHFFPRCSKVIDKFLGDDLSGLSIVEHINTEERKNRYNEILEEMNMAFTQD 549 Query: 303 KN-----ANEESTSRPATSKSARSVRTKIARK 223 KN + S S ++SKSAR+ R K+A+K Sbjct: 550 KNEKAFGRSAASCSAASSSKSARAARNKVAKK 581 >ref|XP_018678587.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 520 Score = 103 bits (257), Expect = 1e-22 Identities = 56/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV+LGM FFPRCSKVIDK LGDD E +VE +NTEERKNRY EIL E AF +D Sbjct: 433 ALTKTVQLGMHFFPRCSKVIDKILGDDLSELSIVEHINTEERKNRYTEILEEINNAFTQD 492 Query: 303 KNANEESTS-RPATSKSARSVRTKIARK 223 K A + S S ++SKSAR+VR+K ARK Sbjct: 493 KTAFDRSVSCSTSSSKSARAVRSKAARK 520 >ref|XP_009392990.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 568 Score = 103 bits (257), Expect = 1e-22 Identities = 56/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV+LGM FFPRCSKVIDK LGDD E +VE +NTEERKNRY EIL E AF +D Sbjct: 481 ALTKTVQLGMHFFPRCSKVIDKILGDDLSELSIVEHINTEERKNRYTEILEEINNAFTQD 540 Query: 303 KNANEESTS-RPATSKSARSVRTKIARK 223 K A + S S ++SKSAR+VR+K ARK Sbjct: 541 KTAFDRSVSCSTSSSKSARAVRSKAARK 568 >gb|AHF20182.1| non-expressor of pr1, partial [Musa acuminata AAA Group] Length = 581 Score = 99.0 bits (245), Expect = 5e-21 Identities = 52/92 (56%), Positives = 64/92 (69%), Gaps = 5/92 (5%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV+LG FFPRCSKVID+FLGDD +VE +NTEERKNRYNEIL E +AF +D Sbjct: 490 ALTKTVQLGTHFFPRCSKVIDRFLGDDLSGLSIVEHINTEERKNRYNEILEEMNMAFTQD 549 Query: 303 KN-----ANEESTSRPATSKSARSVRTKIARK 223 KN + S S +SKS R+ R K+A+K Sbjct: 550 KNEKAFAGSAASCSAALSSKSVRAARNKVAKK 581 >ref|XP_009385599.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 575 Score = 94.4 bits (233), Expect = 2e-19 Identities = 51/86 (59%), Positives = 64/86 (74%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV+LGM FFPRCS +I+K L DD E +VE V+TEERKNRYNEIL E K AF ED Sbjct: 490 ALSKTVQLGMRFFPRCSNIINKILCDDLSELSIVERVDTEERKNRYNEILEEMKKAFTED 549 Query: 303 KNANEESTSRPATSKSARSVRTKIAR 226 K + S S ++SKSAR+VR ++A+ Sbjct: 550 KKKFDGSAS-ASSSKSARAVRARVAK 574 >ref|XP_010924980.1| PREDICTED: BTB/POZ domain and ankyrin repeat-containing protein NPR1 isoform X1 [Elaeis guineensis] Length = 559 Score = 76.3 bits (186), Expect = 4e-13 Identities = 41/87 (47%), Positives = 54/87 (62%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL TV +GM FFPRCSKV++K + DD E +E + +EERK RY E+ E AF +D Sbjct: 473 ALCRTVEVGMHFFPRCSKVLNKIVDDDLSEFTGLEHITSEERKRRYLELQDEMMKAFSQD 532 Query: 303 KNANEESTSRPATSKSARSVRTKIARK 223 K +S +SKS R VR K+A+K Sbjct: 533 KEEFPKSVLPSPSSKSVRVVRAKVAKK 559 >ref|XP_008807141.1| PREDICTED: regulatory protein NPR1-like isoform X1 [Phoenix dactylifera] Length = 562 Score = 75.5 bits (184), Expect = 8e-13 Identities = 41/87 (47%), Positives = 54/87 (62%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL TV LGM FFPRCS+V++K + DD E +E + +EERK RY E+ E AF +D Sbjct: 476 ALYRTVELGMRFFPRCSRVLNKIVDDDLSEFAGLEHITSEERKRRYLELQDEMMKAFSQD 535 Query: 303 KNANEESTSRPATSKSARSVRTKIARK 223 + S +SKS R VRTK+A+K Sbjct: 536 REELPRSALPTPSSKSLRVVRTKLAKK 562 >ref|XP_002455011.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Sorghum bicolor] gb|EES00131.1| hypothetical protein SORBI_3003G032000 [Sorghum bicolor] Length = 583 Score = 61.6 bits (148), Expect = 5e-08 Identities = 33/80 (41%), Positives = 48/80 (60%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV LG FFPRCSKV+DK + D+ L +T E+K R++++ AF ED Sbjct: 496 ALAKTVELGKRFFPRCSKVLDKIMDDETELASLGRDTST-EKKRRFHDLQDLVHKAFSED 554 Query: 303 KNANEESTSRPATSKSARSV 244 K N+ S +R ++S S S+ Sbjct: 555 KEENDRSAARSSSSSSTTSI 574 >ref|XP_006386278.1| hypothetical protein POPTR_0002s05750g [Populus trichocarpa] Length = 167 Score = 59.3 bits (142), Expect = 6e-08 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 6/93 (6%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKN---RYNEILGEFKLAF 313 AL +TV G +FP CSKV+DKFL DD P+ ++ EE+K R+ E+ + + AF Sbjct: 74 ALHKTVETGRHYFPHCSKVVDKFLDDDMPDALFLDKGTPEEQKTKKMRFTELKDDVQKAF 133 Query: 312 ---MEDKNANEESTSRPATSKSARSVRTKIARK 223 ME+ N + S+S ++S V K RK Sbjct: 134 YKDMENNNRSARSSSSSSSSSPKSGVTYKARRK 166 >ref|XP_020097395.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1-like [Ananas comosus] ref|XP_020097396.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1-like [Ananas comosus] Length = 595 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/84 (42%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV LG FFPRCS+V+DK + D+ E E TEE+ R E+ G + AF ED Sbjct: 511 ALAKTVELGKRFFPRCSRVLDKIMDDETAELTCREKDITEEKSRRLLELQGALEKAFCED 570 Query: 303 KNANEES-TSRPATSKSARSVRTK 235 K + S S ++S SA RT+ Sbjct: 571 KEEYDRSAVSSSSSSTSAGVFRTR 594 >gb|OAY83040.1| Regulatory protein NPR1 [Ananas comosus] Length = 595 Score = 60.1 bits (144), Expect = 2e-07 Identities = 36/84 (42%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV LG FFPRCS+V+DK + D+ E E TEE+ R E+ G + AF ED Sbjct: 511 ALAKTVELGKRFFPRCSRVLDKIMDDETAELTCREKDITEEKSRRLLELQGALEKAFCED 570 Query: 303 KNANEES-TSRPATSKSARSVRTK 235 K + S S ++S SA RT+ Sbjct: 571 KEEYDRSAVSSSSSSTSAGVFRTR 594 >ref|XP_007048936.2| PREDICTED: regulatory protein NPR3 [Theobroma cacao] Length = 583 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 3/83 (3%) Frame = -1 Query: 480 LKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEE---RKNRYNEILGEFKLAFM 310 L TV G +FP CS V+DKFL DD +P LVE ++EE +K R+ E+ E + AF Sbjct: 487 LLRTVETGRRYFPLCSDVLDKFLVDDMSDPSLVEEGSSEEQRLKKRRFTELKEELQQAFY 546 Query: 309 EDKNANEESTSRPATSKSARSVR 241 +D + ST P+ S S+ + + Sbjct: 547 KDIEQKKRSTLSPSCSASSSTAK 569 >gb|EOX93093.1| NPR1-like protein 3, putative [Theobroma cacao] Length = 583 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 3/83 (3%) Frame = -1 Query: 480 LKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEE---RKNRYNEILGEFKLAFM 310 L TV G +FP CS V+DKFL DD +P LVE ++EE +K R+ E+ E + AF Sbjct: 487 LLRTVETGRRYFPLCSDVLDKFLVDDMSDPSLVEEGSSEEQRLKKRRFTELKEELQQAFY 546 Query: 309 EDKNANEESTSRPATSKSARSVR 241 +D + ST P+ S S+ + + Sbjct: 547 KDIEQKKRSTLSPSCSASSSTAK 569 >gb|ADP68616.1| NPR disease resistance protein, partial [Setaria italica] Length = 405 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTE-ERKNRYNEILGEFKLAFME 307 AL +TV LG FFPRCSKV+D+F+ D+ L +T E+K R++++ + AF E Sbjct: 318 ALSKTVELGKRFFPRCSKVLDQFMDDENELASLGRDTSTSTEKKRRFHDLQDVLQKAFSE 377 Query: 306 DKNANEESTSRPATSKSARSV 244 DK N+ S + S S+ Sbjct: 378 DKEENDRSARSSSVSSRTTSI 398 >ref|XP_004968514.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1 [Setaria italica] gb|KQL04814.1| hypothetical protein SETIT_000814mg [Setaria italica] Length = 578 Score = 58.5 bits (140), Expect = 6e-07 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTE-ERKNRYNEILGEFKLAFME 307 AL +TV LG FFPRCSKV+D+F+ D+ L +T E+K R++++ + AF E Sbjct: 491 ALSKTVELGKRFFPRCSKVLDQFMDDENELASLGRDTSTSTEKKRRFHDLQDVLQKAFSE 550 Query: 306 DKNANEESTSRPATSKSARSV 244 DK N+ S + S S+ Sbjct: 551 DKEENDRSARSSSVSSRTTSI 571 >ref|XP_020183881.1| BTB/POZ domain and ankyrin repeat-containing protein NPR1-like [Aegilops tauschii subsp. tauschii] Length = 580 Score = 58.5 bits (140), Expect = 6e-07 Identities = 33/85 (38%), Positives = 47/85 (55%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV LG FFPRCS V+DK + DD PE + ERK R++++ AF ED Sbjct: 492 ALSKTVELGKRFFPRCSNVLDKIM-DDEPELASLGTDACSERKRRFHDLQDTLLKAFSED 550 Query: 303 KNANEESTSRPATSKSARSVRTKIA 229 K +T+ ++S S +V +A Sbjct: 551 KEEFNRTTTLSSSSSSTSTVARNLA 575 >ref|XP_021301180.1| BTB/POZ domain and ankyrin repeat-containing protein NPR2-like [Herrania umbratica] Length = 590 Score = 58.5 bits (140), Expect = 6e-07 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 3/83 (3%) Frame = -1 Query: 480 LKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEE---RKNRYNEILGEFKLAFM 310 L TV G +FP CS V+DKFL DD +P L E + EE +K R+ E+ E + AF Sbjct: 487 LLRTVATGRRYFPHCSDVLDKFLVDDMSDPSLFEEGSPEEQRLKKRRFTELKEELQQAFY 546 Query: 309 EDKNANEESTSRPATSKSARSVR 241 +D + STS P+ S S+ + + Sbjct: 547 KDIAEKKRSTSSPSCSSSSSTAK 569 >gb|AKH61408.1| nonexpressor of pathogenesis-related protein 1-like 2 protein [Persea americana var. drymifolia] Length = 590 Score = 58.5 bits (140), Expect = 6e-07 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 9/92 (9%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEE--------RKNRYNEILGE 328 AL TV LG FFPRCS V++ + DD L E N E +K R+NEI Sbjct: 497 ALSRTVELGKRFFPRCSAVLNNIVDDDE----LSELANLETGSWHDRETKKQRFNEIQNI 552 Query: 327 FKLAFMEDKNANEEST-SRPATSKSARSVRTK 235 F AF+EDK N+ ST S ++S S+ S+R + Sbjct: 553 FTKAFIEDKQENDRSTASAISSSSSSTSIRAQ 584 >ref|XP_006645596.1| PREDICTED: regulatory protein NPR1 [Oryza brachyantha] Length = 480 Score = 58.2 bits (139), Expect = 8e-07 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Frame = -1 Query: 483 ALKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEERKNRYNEILGEFKLAFMED 304 AL +TV LG FFPRCS V+DK + DD +P + + E+K R+N++ + AF ED Sbjct: 397 ALSKTVELGKRFFPRCSNVLDKIM-DDETDPVSLGRDTSAEKKRRFNDLQDVLRKAFHED 455 Query: 303 KNANEEST-SRPATSKSARSVRTK 235 K A + S S ++S S ++R + Sbjct: 456 KEAYDRSALSSSSSSTSIGAIRPR 479 >ref|XP_017609711.1| PREDICTED: regulatory protein NPR3-like [Gossypium arboreum] Length = 573 Score = 58.2 bits (139), Expect = 8e-07 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 3/86 (3%) Frame = -1 Query: 480 LKETVRLGMFFFPRCSKVIDKFLGDDPPEPPLVECVNTEE---RKNRYNEILGEFKLAFM 310 L +TV G +FP C++V+DKFL DD +P E ++EE +K R+ E+ E AF Sbjct: 477 LFKTVETGRRYFPHCAEVLDKFLVDDMSDPSFFEDGSSEEQRVKKRRFTELKEELLEAFY 536 Query: 309 EDKNANEESTSRPATSKSARSVRTKI 232 +DK ++ +P S S+ S TK+ Sbjct: 537 KDKADQKKHNHKPVLSPSSSSSTTKL 562