BLASTX nr result
ID: Cheilocostus21_contig00014983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00014983 (852 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009386739.1| PREDICTED: UPF0496 protein 1-like [Musa acum... 53 2e-09 >ref|XP_009386739.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis] Length = 414 Score = 53.1 bits (126), Expect(2) = 2e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -3 Query: 850 RDKDLTGRMQFHTMIALKDLKTIKVLADHLETHFNSQLENA 728 R+ +L MQF T IALKDL TI+VL D LE HFNS LENA Sbjct: 315 RETELLTSMQFGTFIALKDLDTIRVLVDKLEIHFNSLLENA 355 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = -1 Query: 669 EEFTTSIKGLAKEVDRCRKNTVTARRVVLQKIMKHP 562 E F +I+ L +VDRC ++T AR VV++ I+KHP Sbjct: 377 EVFMKNIEDLGVQVDRCSRDTSKARMVVVRTIIKHP 412