BLASTX nr result
ID: Cheilocostus21_contig00014753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00014753 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073421133.1| hypothetical protein [Enterococcus faecium] 52 1e-05 >ref|WP_073421133.1| hypothetical protein [Enterococcus faecium] Length = 73 Score = 52.0 bits (123), Expect = 1e-05 Identities = 30/56 (53%), Positives = 33/56 (58%) Frame = -3 Query: 594 FFLMIRRPPRSTLFPYTTLFRFLKWSVAQCSFPK*LHGLHVRTKSLIGLTYCLCKH 427 FFLMIRRPPRSTLFPYTTLFR + Q K H L SL G+ + KH Sbjct: 7 FFLMIRRPPRSTLFPYTTLFRSQE-KEGQLDVLKLKHALSAWQTSLDGIGWKFAKH 61