BLASTX nr result
ID: Cheilocostus21_contig00014677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00014677 (629 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS53345.1| Omega-3 fatty acid desaturase, chloroplastic [Tri... 127 2e-32 gb|PKI46673.1| hypothetical protein CRG98_033015 [Punica granatum] 122 1e-31 emb|CDP14009.1| unnamed protein product [Coffea canephora] 125 5e-31 ref|XP_015897249.1| PREDICTED: omega-3 fatty acid desaturase, ch... 127 8e-31 ref|XP_009384918.1| PREDICTED: omega-3 fatty acid desaturase, ch... 126 1e-30 gb|PIN06124.1| Delta(12)-fatty acid dehydrogenase [Handroanthus ... 126 1e-30 gb|KMZ68717.1| omega-3 fatty acid desaturase [Zostera marina] 126 1e-30 ref|XP_003562400.1| PREDICTED: omega-3 fatty acid desaturase, ch... 125 1e-30 gb|OIW01186.1| hypothetical protein TanjilG_10347 [Lupinus angus... 125 2e-30 dbj|BAA07785.3| plastid omega-3 fatty acid desaturase, partial [... 124 2e-30 gb|AHE41324.1| chloroplast omega-3 fatty acid desaturase, partia... 125 2e-30 ref|XP_019460571.1| PREDICTED: omega-3 fatty acid desaturase, ch... 125 2e-30 ref|XP_022746349.1| omega-3 fatty acid desaturase, chloroplastic... 125 4e-30 ref|XP_010031732.1| PREDICTED: omega-3 fatty acid desaturase, ch... 125 4e-30 dbj|BAJ93756.1| predicted protein [Hordeum vulgare subsp. vulgare] 124 4e-30 ref|XP_020162807.1| omega-3 fatty acid desaturase, chloroplastic... 124 5e-30 ref|XP_019450336.1| PREDICTED: omega-3 fatty acid desaturase, ch... 124 5e-30 ref|XP_019151176.1| PREDICTED: omega-3 fatty acid desaturase, ch... 124 5e-30 ref|XP_021906298.1| omega-3 fatty acid desaturase, chloroplastic... 124 5e-30 gb|OVA02710.1| Fatty acid desaturase [Macleaya cordata] 124 6e-30 >gb|EMS53345.1| Omega-3 fatty acid desaturase, chloroplastic [Triticum urartu] Length = 292 Score = 127 bits (320), Expect = 2e-32 Identities = 56/70 (80%), Positives = 64/70 (91%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS PFPFHLFG L RS+K+DHYVSDTG+IIYYQ Sbjct: 220 PQIPHYHLVEATEAAKPVLGKYYREPDKSGPFPFHLFGALARSMKSDHYVSDTGDIIYYQ 279 Query: 447 ADPQLSGASE 418 DP+L+G ++ Sbjct: 280 TDPKLAGGAQ 289 >gb|PKI46673.1| hypothetical protein CRG98_033015 [Punica granatum] Length = 160 Score = 122 bits (306), Expect = 1e-31 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYY+EP KS P PFHL GVLL+S+K DHYVSD+G+++YYQ Sbjct: 89 PQIPHYHLIEATEAAKPVLGKYYKEPKKSGPLPFHLLGVLLKSMKEDHYVSDSGDVVYYQ 148 Query: 447 ADPQLSGASEIK 412 DPQL G+ K Sbjct: 149 RDPQLFGSESSK 160 >emb|CDP14009.1| unnamed protein product [Coffea canephora] Length = 327 Score = 125 bits (313), Expect = 5e-31 Identities = 54/71 (76%), Positives = 64/71 (90%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAA+PVLGKYYREP KS P P HL GVL+RS++ DHYVSDTGE++YYQ Sbjct: 256 PQIPHYHLIEATEAARPVLGKYYREPKKSRPLPLHLLGVLVRSMRKDHYVSDTGEVVYYQ 315 Query: 447 ADPQLSGASEI 415 +DPQLSG+ ++ Sbjct: 316 SDPQLSGSRKL 326 >ref|XP_015897249.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Ziziphus jujuba] Length = 458 Score = 127 bits (318), Expect = 8e-31 Identities = 58/72 (80%), Positives = 64/72 (88%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP KS P PFHLFG LLRSLK DHYVSDTG+++YYQ Sbjct: 387 PQIPHYHLIEATEAAKPVLGKYYREPKKSGPIPFHLFGDLLRSLKQDHYVSDTGDVVYYQ 446 Query: 447 ADPQLSGASEIK 412 D +LSG+S+ K Sbjct: 447 TDSELSGSSKSK 458 >ref|XP_009384918.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 447 Score = 126 bits (317), Expect = 1e-30 Identities = 55/72 (76%), Positives = 64/72 (88%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKP+LGKYYREP KS P PFHLFGVL+RSL DH+VSD G+++YYQ Sbjct: 372 PQIPHYHLVEATEAAKPILGKYYREPVKSGPLPFHLFGVLMRSLGCDHFVSDIGDVVYYQ 431 Query: 447 ADPQLSGASEIK 412 DP+L+GASE K Sbjct: 432 TDPRLNGASEAK 443 >gb|PIN06124.1| Delta(12)-fatty acid dehydrogenase [Handroanthus impetiginosus] Length = 449 Score = 126 bits (317), Expect = 1e-30 Identities = 55/70 (78%), Positives = 64/70 (91%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP KS P PFHLFGVLLRS+K DHYVS+TG+++YY+ Sbjct: 379 PQIPHYHLIEATEAAKPVLGKYYREPKKSSPLPFHLFGVLLRSMKKDHYVSNTGDVVYYE 438 Query: 447 ADPQLSGASE 418 DP+LSG+ + Sbjct: 439 TDPKLSGSEK 448 >gb|KMZ68717.1| omega-3 fatty acid desaturase [Zostera marina] Length = 464 Score = 126 bits (317), Expect = 1e-30 Identities = 57/67 (85%), Positives = 61/67 (91%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLG+YYREP KS P PFHLFGVL RS+K DHYVSDTG+I+YYQ Sbjct: 391 PQIPHYHLIEATEAAKPVLGRYYREPEKSSPLPFHLFGVLGRSMKRDHYVSDTGDIVYYQ 450 Query: 447 ADPQLSG 427 DPQLSG Sbjct: 451 TDPQLSG 457 >ref|XP_003562400.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Brachypodium distachyon] gb|KQK14478.1| hypothetical protein BRADI_1g16580v3 [Brachypodium distachyon] Length = 428 Score = 125 bits (315), Expect = 1e-30 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS PFPFHLFG L RSLK DHYVSDTG+IIYYQ Sbjct: 356 PQIPHYHLVEATEAAKPVLGKYYREPDKSGPFPFHLFGALARSLKRDHYVSDTGDIIYYQ 415 Query: 447 ADPQLSGAS 421 DP+++G + Sbjct: 416 TDPKVAGGA 424 >gb|OIW01186.1| hypothetical protein TanjilG_10347 [Lupinus angustifolius] Length = 411 Score = 125 bits (314), Expect = 2e-30 Identities = 56/70 (80%), Positives = 63/70 (90%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS P PFHL G LLRSL DH+VSDTG+++YYQ Sbjct: 340 PQIPHYHLVEATEAAKPVLGKYYREPKKSSPIPFHLIGDLLRSLGKDHFVSDTGDVVYYQ 399 Query: 447 ADPQLSGASE 418 ADP+LSGAS+ Sbjct: 400 ADPELSGASK 409 >dbj|BAA07785.3| plastid omega-3 fatty acid desaturase, partial [Triticum aestivum] Length = 381 Score = 124 bits (312), Expect = 2e-30 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS PFPFHLFG L RS+K+DHYVSDTG+IIYYQ Sbjct: 309 PQIPHYHLVEATEAAKPVLGKYYREPDKSGPFPFHLFGALARSMKSDHYVSDTGDIIYYQ 368 Query: 447 ADPQLSGAS 421 DP+L+ + Sbjct: 369 TDPKLAAGA 377 >gb|AHE41324.1| chloroplast omega-3 fatty acid desaturase, partial [Sesamum radiatum] Length = 433 Score = 125 bits (314), Expect = 2e-30 Identities = 57/71 (80%), Positives = 61/71 (85%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP KS P PFHL G L RSLK DHYVSD G+++YYQ Sbjct: 309 PQIPHYHLIEATEAAKPVLGKYYREPKKSAPLPFHLLGDLTRSLKRDHYVSDVGDVVYYQ 368 Query: 447 ADPQLSGASEI 415 DPQL+GA EI Sbjct: 369 TDPQLTGAREI 379 >ref|XP_019460571.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Lupinus angustifolius] Length = 438 Score = 125 bits (314), Expect = 2e-30 Identities = 56/70 (80%), Positives = 63/70 (90%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS P PFHL G LLRSL DH+VSDTG+++YYQ Sbjct: 367 PQIPHYHLVEATEAAKPVLGKYYREPKKSSPIPFHLIGDLLRSLGKDHFVSDTGDVVYYQ 426 Query: 447 ADPQLSGASE 418 ADP+LSGAS+ Sbjct: 427 ADPELSGASK 436 >ref|XP_022746349.1| omega-3 fatty acid desaturase, chloroplastic-like [Durio zibethinus] Length = 455 Score = 125 bits (313), Expect = 4e-30 Identities = 54/70 (77%), Positives = 62/70 (88%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEAT+AAKPVLGKYYREP KS P PFHLFG+L+RS+K DHYVSD G+++YYQ Sbjct: 384 PQIPHYHLIEATKAAKPVLGKYYREPKKSSPIPFHLFGILIRSMKQDHYVSDIGDVVYYQ 443 Query: 447 ADPQLSGASE 418 DPQL G S+ Sbjct: 444 TDPQLYGTSK 453 >ref|XP_010031732.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Eucalyptus grandis] gb|KCW88132.1| hypothetical protein EUGRSUZ_A00526 [Eucalyptus grandis] gb|KCW88133.1| hypothetical protein EUGRSUZ_A00526 [Eucalyptus grandis] Length = 461 Score = 125 bits (313), Expect = 4e-30 Identities = 55/67 (82%), Positives = 60/67 (89%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP KS P PFHL G+L+RSLK DHYVSDTGE++YYQ Sbjct: 386 PQIPHYHLIEATEAAKPVLGKYYREPKKSSPLPFHLIGMLIRSLKRDHYVSDTGEVVYYQ 445 Query: 447 ADPQLSG 427 DP+L G Sbjct: 446 TDPKLGG 452 >dbj|BAJ93756.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 438 Score = 124 bits (312), Expect = 4e-30 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS PFPFHLFG L RS+K+DHYVSDTG+IIYYQ Sbjct: 366 PQIPHYHLVEATEAAKPVLGKYYREPDKSGPFPFHLFGALARSMKSDHYVSDTGDIIYYQ 425 Query: 447 ADPQLSGAS 421 DP+L+ + Sbjct: 426 TDPKLAAGA 434 >ref|XP_020162807.1| omega-3 fatty acid desaturase, chloroplastic [Aegilops tauschii subsp. tauschii] Length = 439 Score = 124 bits (312), Expect = 5e-30 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL+EATEAAKPVLGKYYREP KS PFPFHLFG L RS+K+DHYVSDTG+IIYYQ Sbjct: 367 PQIPHYHLVEATEAAKPVLGKYYREPDKSGPFPFHLFGALARSMKSDHYVSDTGDIIYYQ 426 Query: 447 ADPQLSGAS 421 DP+L+ + Sbjct: 427 TDPKLAAGA 435 >ref|XP_019450336.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Lupinus angustifolius] ref|XP_019450338.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Lupinus angustifolius] gb|OIW07457.1| hypothetical protein TanjilG_24319 [Lupinus angustifolius] Length = 439 Score = 124 bits (312), Expect = 5e-30 Identities = 57/70 (81%), Positives = 63/70 (90%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP KS P PFHL G LLRSLK DH+VSDTG+I+YYQ Sbjct: 370 PQIPHYHLIEATEAAKPVLGKYYREPKKSGPIPFHLVGDLLRSLKKDHFVSDTGDIVYYQ 429 Query: 447 ADPQLSGASE 418 +DP LSG+S+ Sbjct: 430 SDPNLSGSSK 439 >ref|XP_019151176.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Ipomoea nil] Length = 450 Score = 124 bits (312), Expect = 5e-30 Identities = 54/68 (79%), Positives = 62/68 (91%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHL EATEAAKPVLGKYYREP KS P PFHL G L+RS+KTDHYVSDTG+++YYQ Sbjct: 379 PQIPHYHLTEATEAAKPVLGKYYREPKKSSPLPFHLLGDLIRSMKTDHYVSDTGDVVYYQ 438 Query: 447 ADPQLSGA 424 +DP+LSG+ Sbjct: 439 SDPELSGS 446 >ref|XP_021906298.1| omega-3 fatty acid desaturase, chloroplastic-like [Carica papaya] Length = 454 Score = 124 bits (312), Expect = 5e-30 Identities = 55/70 (78%), Positives = 62/70 (88%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP KS P PFHL G L+RSL+ DHYVSDTG+++YYQ Sbjct: 383 PQIPHYHLIEATEAAKPVLGKYYREPEKSGPLPFHLIGSLIRSLRIDHYVSDTGDVVYYQ 442 Query: 447 ADPQLSGASE 418 DPQLSG ++ Sbjct: 443 TDPQLSGCAK 452 >gb|OVA02710.1| Fatty acid desaturase [Macleaya cordata] Length = 459 Score = 124 bits (312), Expect = 6e-30 Identities = 56/72 (77%), Positives = 64/72 (88%) Frame = -3 Query: 627 PQIPHYHLIEATEAAKPVLGKYYREPAKSEPFPFHLFGVLLRSLKTDHYVSDTGEIIYYQ 448 PQIPHYHLIEATEAAKPVLGKYYREP +S P PFHL G L+RSL+ DHYVSDTG+I+YYQ Sbjct: 386 PQIPHYHLIEATEAAKPVLGKYYREPKRSGPLPFHLIGSLVRSLRQDHYVSDTGDILYYQ 445 Query: 447 ADPQLSGASEIK 412 DPQL+G+S+ K Sbjct: 446 TDPQLNGSSQEK 457