BLASTX nr result
ID: Cheilocostus21_contig00014301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00014301 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN31053.1| unknown [Zea mays] 62 2e-09 >gb|ACN31053.1| unknown [Zea mays] Length = 83 Score = 61.6 bits (148), Expect = 2e-09 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 5/70 (7%) Frame = -2 Query: 195 HRPSGFMICENTALGVNPTESSLTVLRLAMLFE-VVVVVMLKSIIGSFCFLLSSF----S 31 HRP GFMICE TALGV+P+ES L L ML E VVVVV+L SI GSF + S Sbjct: 7 HRPLGFMICEKTALGVSPSESILATLWSPMLIEVVVVVVVLDSIDGSFGSFFPTINGAPS 66 Query: 30 TELPPMMLPL 1 +++P LPL Sbjct: 67 SDIPQPRLPL 76