BLASTX nr result
ID: Cheilocostus21_contig00014233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00014233 (675 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383374.1| PREDICTED: sigma factor binding protein 2, c... 65 9e-10 >ref|XP_009383374.1| PREDICTED: sigma factor binding protein 2, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 141 Score = 65.1 bits (157), Expect = 9e-10 Identities = 44/95 (46%), Positives = 51/95 (53%), Gaps = 12/95 (12%) Frame = -3 Query: 673 SNPTKVNASVHEFRSVVQELTGRDSGEANLAKYSEASNEGSAGGDLPP---PSAVEPPSQ 503 SNP KV ASV EFRSVVQELTG+DS A +KY + GD PP P ++ Sbjct: 28 SNPMKVKASVAEFRSVVQELTGQDSDIAGFSKYRSVDTD---SGDPPPSNSPGLAVESTR 84 Query: 502 TNPGGADLRND---------YELNEYFVDLPEMLD 425 NP G DL D EL+EYF D+ EM D Sbjct: 85 ANPSGTDLLYDACRRITSPVRELDEYF-DVSEMRD 118