BLASTX nr result
ID: Cheilocostus21_contig00014144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00014144 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009389854.1| PREDICTED: MADS-box protein SOC1-like [Musa ... 58 7e-07 >ref|XP_009389854.1| PREDICTED: MADS-box protein SOC1-like [Musa acuminata subsp. malaccensis] Length = 255 Score = 57.8 bits (138), Expect = 7e-07 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = +3 Query: 3 NKVLREQCKLQLELSFAYPKEIVLYDTSSQHNEVETELCIGCPGRGTRN 149 N +LRE KLQ +L A KE+V YD S ++ EVETELCIGCPGRG R+ Sbjct: 204 NTLLRE--KLQHKLPSAASKEVVPYDISGEYAEVETELCIGCPGRGRRS 250