BLASTX nr result
ID: Cheilocostus21_contig00013953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00013953 (999 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010940964.1| PREDICTED: putative invertase inhibitor [Ela... 59 1e-06 >ref|XP_010940964.1| PREDICTED: putative invertase inhibitor [Elaeis guineensis] Length = 170 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/103 (30%), Positives = 53/103 (51%) Frame = +1 Query: 610 EVCGNLDDAYITKEMCTSFFSADPDADKAPNIRSLEIIASNITLRKAVEILLLVKEAEKN 789 + CG + Y+ + C ADP + A NIR L I+ +++ A + ++E K Sbjct: 28 KACGKIAKGYVGYKFCVQALEADPKSGSA-NIRGLASISVKLSIANATSTVSKIRELLKK 86 Query: 790 ATDAAIKRHAATAVRLFSHAVASLELVKHYIAAGNMAAKSADV 918 A+D IK L+++A ASL+ +H+IA+ N A A++ Sbjct: 87 ASDPTIKNSLQACSYLYTNAKASLKWSEHFIASKNFTAAKAEI 129