BLASTX nr result
ID: Cheilocostus21_contig00013835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00013835 (1962 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF40468.1|AC004809_26 Contains similarity to the synaptobrev... 61 3e-08 ref|XP_020092117.1| uncharacterized protein LOC109712774 [Ananas... 62 5e-08 gb|PRQ35866.1| putative Longin-like domain-containing protein [R... 66 7e-08 ref|XP_018481595.1| PREDICTED: putative vesicle-associated membr... 64 2e-07 gb|EEC81677.1| hypothetical protein OsI_25239 [Oryza sativa Indi... 62 5e-07 gb|EXC72741.1| Putative vesicle-associated membrane protein 726 ... 59 6e-07 gb|OAY63617.1| putative vesicle-associated membrane protein 726 ... 62 8e-07 gb|AQK62270.1| Vesicle-associated membrane protein 722, partial ... 59 9e-07 gb|ONM10425.1| Vesicle-associated membrane protein 722, partial ... 59 9e-07 gb|AQK58809.1| Putative vesicle-associated membrane protein fami... 59 1e-06 ref|XP_024008616.1| putative vesicle-associated membrane protein... 61 1e-06 gb|KZV57809.1| vesicle-associated membrane protein 722 [Dorcocer... 61 1e-06 gb|KZV56435.1| vesicle-associated membrane protein 722 [Dorcocer... 61 1e-06 ref|XP_011083121.1| vesicle-associated membrane protein 721 [Ses... 61 1e-06 ref|XP_011080177.1| vesicle-associated membrane protein 721 [Ses... 61 1e-06 emb|CDP03855.1| unnamed protein product [Coffea canephora] 61 1e-06 ref|XP_012830313.1| PREDICTED: vesicle-associated membrane prote... 61 1e-06 ref|XP_012829034.1| PREDICTED: vesicle-associated membrane prote... 61 1e-06 gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea] 61 1e-06 ref|XP_023759804.1| vesicle-associated membrane protein 722 [Lac... 61 1e-06 >gb|AAF40468.1|AC004809_26 Contains similarity to the synaptobrevin-related protein (SAR1) gb|M901418. ESTs gb|T44122 and gb|AA067474 come from this gene [Arabidopsis thaliana] Length = 69 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSES 86 LP++NNKFTYNCDGHTFNYLVEDGFS+S Sbjct: 39 LPSSNNKFTYNCDGHTFNYLVEDGFSKS 66 >ref|XP_020092117.1| uncharacterized protein LOC109712774 [Ananas comosus] Length = 129 Score = 62.4 bits (150), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSE 83 LPA+NNKFTYNCDGHTFNYLVEDGFSE Sbjct: 39 LPASNNKFTYNCDGHTFNYLVEDGFSE 65 >gb|PRQ35866.1| putative Longin-like domain-containing protein [Rosa chinensis] Length = 347 Score = 66.2 bits (160), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSESPLP 95 LPA+NNKFTYNCDGHTFNYLVE+GFSESP P Sbjct: 39 LPASNNKFTYNCDGHTFNYLVENGFSESPPP 69 >ref|XP_018481595.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform X1 [Raphanus sativus] ref|XP_018437810.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform X1 [Raphanus sativus] Length = 228 Score = 63.5 bits (153), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSESP 89 LP++NNKFTYNCDGHTFNYLVE+GFSESP Sbjct: 39 LPSSNNKFTYNCDGHTFNYLVENGFSESP 67 >gb|EEC81677.1| hypothetical protein OsI_25239 [Oryza sativa Indica Group] gb|EEE66734.1| hypothetical protein OsJ_23425 [Oryza sativa Japonica Group] Length = 249 Score = 62.4 bits (150), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSESPLPLRG 104 LPA+NNKFTYNCDGHTFNYLVEDGFS + + + G Sbjct: 39 LPASNNKFTYNCDGHTFNYLVEDGFSSNRIGILG 72 >gb|EXC72741.1| Putative vesicle-associated membrane protein 726 [Morus notabilis] Length = 101 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKF YNCDGHTFNYLV+DGFS Sbjct: 39 LPATNNKFIYNCDGHTFNYLVDDGFS 64 >gb|OAY63617.1| putative vesicle-associated membrane protein 726 [Ananas comosus] Length = 285 Score = 62.4 bits (150), Expect = 8e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSE 83 LPA+NNKFTYNCDGHTFNYLVEDGFSE Sbjct: 39 LPASNNKFTYNCDGHTFNYLVEDGFSE 65 >gb|AQK62270.1| Vesicle-associated membrane protein 722, partial [Zea mays] Length = 145 Score = 59.3 bits (142), Expect = 9e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPA+NNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPASNNKFTYNCDGHTFNYLVEDGFT 64 >gb|ONM10425.1| Vesicle-associated membrane protein 722, partial [Zea mays] Length = 145 Score = 59.3 bits (142), Expect = 9e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPA+NNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPASNNKFTYNCDGHTFNYLVEDGFT 64 >gb|AQK58809.1| Putative vesicle-associated membrane protein family protein, partial [Zea mays] Length = 134 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGF 77 LPA+NNKFTYNCDGHTFNYLVEDGF Sbjct: 3 LPASNNKFTYNCDGHTFNYLVEDGF 27 >ref|XP_024008616.1| putative vesicle-associated membrane protein 726 isoform X1 [Eutrema salsugineum] Length = 235 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFSESPLPLRGSNSRWLT*VILYDRSA 152 LP++NNKFTYNCDGHTFNYL ++GFS+S +P+ ++S ++ ++ SA Sbjct: 39 LPSSNNKFTYNCDGHTFNYLADNGFSKSLIPISTTSSCGISYCVVVVESA 88 >gb|KZV57809.1| vesicle-associated membrane protein 722 [Dorcoceras hygrometricum] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >gb|KZV56435.1| vesicle-associated membrane protein 722 [Dorcoceras hygrometricum] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >ref|XP_011083121.1| vesicle-associated membrane protein 721 [Sesamum indicum] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >ref|XP_011080177.1| vesicle-associated membrane protein 721 [Sesamum indicum] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >emb|CDP03855.1| unnamed protein product [Coffea canephora] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >ref|XP_012830313.1| PREDICTED: vesicle-associated membrane protein 721 [Erythranthe guttata] gb|EYU46345.1| hypothetical protein MIMGU_mgv1a013442mg [Erythranthe guttata] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >ref|XP_012829034.1| PREDICTED: vesicle-associated membrane protein 722-like [Erythranthe guttata] gb|EYU17981.1| hypothetical protein MIMGU_mgv1a013452mg [Erythranthe guttata] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea] Length = 220 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64 >ref|XP_023759804.1| vesicle-associated membrane protein 722 [Lactuca sativa] gb|PLY88573.1| hypothetical protein LSAT_7X6521 [Lactuca sativa] Length = 221 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 3 LPATNNKFTYNCDGHTFNYLVEDGFS 80 LPATNNKFTYNCDGHTFNYLVEDGF+ Sbjct: 39 LPATNNKFTYNCDGHTFNYLVEDGFT 64