BLASTX nr result
ID: Cheilocostus21_contig00013561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00013561 (847 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023005092.1| transcription factor IBH1 [Cucurbita maxima] 58 8e-07 >ref|XP_023005092.1| transcription factor IBH1 [Cucurbita maxima] Length = 151 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 96 GMLRRVVPGGEGMDCCDLLEETADYIECLSAQ 1 G LRR+VPGG+GMD C LLEETADYI CLSAQ Sbjct: 106 GKLRRLVPGGDGMDVCTLLEETADYIHCLSAQ 137