BLASTX nr result
ID: Cheilocostus21_contig00013361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00013361 (620 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409101.1| PREDICTED: vam6/Vps39-like protein [Musa acu... 70 2e-10 gb|KQK87413.1| hypothetical protein SETIT_0340721mg, partial [Se... 57 2e-07 ref|XP_020582861.1| LOW QUALITY PROTEIN: vam6/Vps39-like protein... 58 3e-06 ref|XP_020084602.1| vam6/Vps39-like protein [Ananas comosus] 58 3e-06 gb|OAY77566.1| Vam6/Vps39-like protein [Ananas comosus] 58 3e-06 ref|XP_002463992.1| vam6/Vps39-like protein [Sorghum bicolor] >g... 57 5e-06 ref|XP_021680652.1| vam6/Vps39-like protein [Hevea brasiliensis] 57 6e-06 ref|XP_020194203.1| vam6/Vps39-like protein isoform X2 [Aegilops... 57 8e-06 gb|KQK13523.1| hypothetical protein BRADI_1g10697v3 [Brachypodiu... 57 8e-06 gb|OEL14786.1| Vam6/Vps39-like protein [Dichanthelium oligosanthes] 57 8e-06 ref|XP_003560617.1| PREDICTED: vam6/Vps39-like protein [Brachypo... 57 8e-06 ref|XP_020194202.1| vam6/Vps39-like protein isoform X1 [Aegilops... 57 8e-06 gb|PAN45358.1| hypothetical protein PAHAL_I01994 [Panicum hallii] 57 8e-06 ref|XP_004981978.1| vam6/Vps39-like protein [Setaria italica] 57 8e-06 gb|PKU70790.1| hypothetical protein MA16_Dca012543 [Dendrobium c... 57 8e-06 ref|XP_020698665.1| vam6/Vps39-like protein [Dendrobium catenatum] 57 8e-06 gb|PNT36366.1| hypothetical protein POPTR_005G123000v3 [Populus ... 57 8e-06 ref|XP_006383195.1| hypothetical protein POPTR_0005s12470g [Popu... 57 8e-06 gb|OVA05137.1| Clathrin [Macleaya cordata] 57 8e-06 >ref|XP_009409101.1| PREDICTED: vam6/Vps39-like protein [Musa acuminata subsp. malaccensis] Length = 1006 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRRT 516 VFA+YPNGKTLVHF+CF+DSQSIKAVRGP T+RRT Sbjct: 972 VFAVYPNGKTLVHFVCFRDSQSIKAVRGPATVRRT 1006 >gb|KQK87413.1| hypothetical protein SETIT_0340721mg, partial [Setaria italica] gb|KQK87414.1| hypothetical protein SETIT_0340721mg, partial [Setaria italica] Length = 66 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 33 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 65 >ref|XP_020582861.1| LOW QUALITY PROTEIN: vam6/Vps39-like protein [Phalaenopsis equestris] Length = 1005 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTT 528 VFA+YPNGKTLVHF+CF+DSQ+IKAVRG T Sbjct: 967 VFAVYPNGKTLVHFVCFRDSQTIKAVRGSGT 997 >ref|XP_020084602.1| vam6/Vps39-like protein [Ananas comosus] Length = 1001 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FA+YPNGKTLVHF+CF+DSQ IKAVRG ++R Sbjct: 968 FAVYPNGKTLVHFVCFRDSQRIKAVRGAPPVKR 1000 >gb|OAY77566.1| Vam6/Vps39-like protein [Ananas comosus] Length = 1001 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FA+YPNGKTLVHF+CF+DSQ IKAVRG ++R Sbjct: 968 FAVYPNGKTLVHFVCFRDSQRIKAVRGAPPVKR 1000 >ref|XP_002463992.1| vam6/Vps39-like protein [Sorghum bicolor] gb|EER90990.1| hypothetical protein SORBI_3001G114000 [Sorghum bicolor] Length = 998 Score = 57.4 bits (137), Expect = 5e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CFK+SQ IKAVRG +++R Sbjct: 965 FAIYPNGQTLVHFVCFKESQQIKAVRGANSLKR 997 >ref|XP_021680652.1| vam6/Vps39-like protein [Hevea brasiliensis] Length = 1008 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 VFA+YPNGKTLVHF+CFKDSQS+KAV T +R+ Sbjct: 974 VFAVYPNGKTLVHFVCFKDSQSMKAVGKGTPLRK 1007 >ref|XP_020194203.1| vam6/Vps39-like protein isoform X2 [Aegilops tauschii subsp. tauschii] Length = 829 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 796 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 828 >gb|KQK13523.1| hypothetical protein BRADI_1g10697v3 [Brachypodium distachyon] Length = 833 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 800 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 832 >gb|OEL14786.1| Vam6/Vps39-like protein [Dichanthelium oligosanthes] Length = 957 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 924 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 956 >ref|XP_003560617.1| PREDICTED: vam6/Vps39-like protein [Brachypodium distachyon] gb|KQK13522.1| hypothetical protein BRADI_1g10697v3 [Brachypodium distachyon] Length = 984 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 951 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 983 >ref|XP_020194202.1| vam6/Vps39-like protein isoform X1 [Aegilops tauschii subsp. tauschii] Length = 985 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 952 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 984 >gb|PAN45358.1| hypothetical protein PAHAL_I01994 [Panicum hallii] Length = 996 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 963 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 995 >ref|XP_004981978.1| vam6/Vps39-like protein [Setaria italica] Length = 997 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 617 FAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 FAIYPNG+TLVHF+CF++SQ IKAVRG +++R Sbjct: 964 FAIYPNGQTLVHFVCFRESQQIKAVRGANSVKR 996 >gb|PKU70790.1| hypothetical protein MA16_Dca012543 [Dendrobium catenatum] Length = 999 Score = 56.6 bits (135), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTT 528 VFA+YPNGKTLVHF+CF+DSQ+IK VRG T Sbjct: 965 VFAVYPNGKTLVHFVCFRDSQTIKTVRGSGT 995 >ref|XP_020698665.1| vam6/Vps39-like protein [Dendrobium catenatum] Length = 1001 Score = 56.6 bits (135), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTT 528 VFA+YPNGKTLVHF+CF+DSQ+IK VRG T Sbjct: 967 VFAVYPNGKTLVHFVCFRDSQTIKTVRGSGT 997 >gb|PNT36366.1| hypothetical protein POPTR_005G123000v3 [Populus trichocarpa] Length = 1008 Score = 56.6 bits (135), Expect = 8e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 VFA+YPNGKT+VHF+CFKDSQSIKAV + +R+ Sbjct: 974 VFAVYPNGKTIVHFVCFKDSQSIKAVAKGSALRK 1007 >ref|XP_006383195.1| hypothetical protein POPTR_0005s12470g [Populus trichocarpa] Length = 1008 Score = 56.6 bits (135), Expect = 8e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 VFA+YPNGKT+VHF+CFKDSQSIKAV + +R+ Sbjct: 974 VFAVYPNGKTIVHFVCFKDSQSIKAVAKGSALRK 1007 >gb|OVA05137.1| Clathrin [Macleaya cordata] Length = 1011 Score = 56.6 bits (135), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 620 VFAIYPNGKTLVHFLCFKDSQSIKAVRGPTTIRR 519 VFA+YPNG TLVHF+CF+DSQSIKAVRG + R Sbjct: 977 VFAVYPNGTTLVHFVCFRDSQSIKAVRGASLRNR 1010