BLASTX nr result
ID: Cheilocostus21_contig00013321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00013321 (1134 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009389564.1| PREDICTED: ethylene-responsive transcription... 60 3e-06 >ref|XP_009389564.1| PREDICTED: ethylene-responsive transcription factor RAP2-13-like [Musa acuminata subsp. malaccensis] Length = 314 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 96 KDKGCNSSPSKAAKLYRGVRQRHWGKWVAEIR 1 K GC++SP K KLYRGVRQRHWGKWVAEIR Sbjct: 129 KRSGCSASPPKPTKLYRGVRQRHWGKWVAEIR 160