BLASTX nr result
ID: Cheilocostus21_contig00012423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00012423 (873 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPR94564.1| hypothetical protein GOBAR_AA26102 [Gossypium bar... 64 7e-08 ref|XP_020683307.1| DEAD-box ATP-dependent RNA helicase 15-like ... 64 1e-07 gb|PPD82193.1| hypothetical protein GOBAR_DD20879 [Gossypium bar... 64 1e-07 ref|XP_010231905.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 4e-07 gb|OEL29981.1| DEAD-box ATP-dependent RNA helicase 56 [Dichanthe... 61 6e-07 >gb|PPR94564.1| hypothetical protein GOBAR_AA26102 [Gossypium barbadense] Length = 458 Score = 64.3 bits (155), Expect = 7e-08 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -2 Query: 125 LKGSRRLFFTYWGTAPILFGSPPVQHECIPQAILGMDVICQ 3 LKGSRRL+FTY G LF VQHECIPQAILGMDVICQ Sbjct: 72 LKGSRRLYFTYAGFLDALFFGSSVQHECIPQAILGMDVICQ 112 >ref|XP_020683307.1| DEAD-box ATP-dependent RNA helicase 15-like isoform X4 [Dendrobium catenatum] Length = 376 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 107 LFFTYWGT-APILFGSPPVQHECIPQAILGMDVICQ 3 +FFT+WG API FG P VQHECIPQAILGMDVICQ Sbjct: 3 MFFTHWGYFAPIFFGYPSVQHECIPQAILGMDVICQ 38 >gb|PPD82193.1| hypothetical protein GOBAR_DD20879 [Gossypium barbadense] Length = 622 Score = 63.9 bits (154), Expect = 1e-07 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -2 Query: 125 LKGSRRLFFTYWGTAPILFGSPPVQHECIPQAILGMDVICQ 3 LKGSRRL+FTY G LF VQHECIPQAILGMDVICQ Sbjct: 72 LKGSRRLYFTYPGFLDALFFGSSVQHECIPQAILGMDVICQ 112 >ref|XP_010231905.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Brachypodium distachyon] Length = 377 Score = 61.6 bits (148), Expect = 4e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 113 RRLFFTYWGTAPILFGSPPVQHECIPQAILGMDVICQ 3 +++ F++WG API F S VQHECIPQAILGMDVICQ Sbjct: 3 QKVKFSHWGAAPIFFASTSVQHECIPQAILGMDVICQ 39 >gb|OEL29981.1| DEAD-box ATP-dependent RNA helicase 56 [Dichanthelium oligosanthes] Length = 390 Score = 61.2 bits (147), Expect = 6e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 101 FTYWGTAPILFGSPPVQHECIPQAILGMDVICQ 3 FT+WG A I FGS VQHECIPQAILGMDVICQ Sbjct: 15 FTHWGAASISFGSTSVQHECIPQAILGMDVICQ 47