BLASTX nr result
ID: Cheilocostus21_contig00012263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00012263 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400003.1| PREDICTED: gamma-interferon-inducible lysoso... 101 1e-23 ref|XP_008777702.1| PREDICTED: gamma-interferon-inducible lysoso... 86 3e-17 ref|XP_010922609.1| PREDICTED: gamma-interferon-inducible lysoso... 84 7e-17 ref|XP_020108015.1| gamma-interferon-inducible lysosomal thiol r... 83 2e-16 ref|XP_020252089.1| gamma-interferon-inducible lysosomal thiol r... 78 8e-16 gb|PKA56182.1| hypothetical protein AXF42_Ash011111 [Apostasia s... 78 2e-14 ref|XP_021306003.1| gamma-interferon-inducible lysosomal thiol r... 76 7e-14 ref|XP_019705948.1| PREDICTED: gamma-interferon-inducible lysoso... 76 7e-14 ref|XP_021305973.1| gamma-interferon-inducible lysosomal thiol r... 76 8e-14 gb|EEC75043.1| hypothetical protein OsI_11143 [Oryza sativa Indi... 76 1e-13 ref|XP_015631077.1| PREDICTED: gamma-interferon-inducible lysoso... 76 1e-13 gb|EAZ26583.1| hypothetical protein OsJ_10480 [Oryza sativa Japo... 76 1e-13 ref|XP_015631076.1| PREDICTED: gamma-interferon-inducible lysoso... 76 1e-13 ref|XP_020271600.1| gamma-interferon-inducible lysosomal thiol r... 74 1e-13 ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysoso... 75 1e-13 gb|PKU73518.1| hypothetical protein MA16_Dca008082 [Dendrobium c... 74 2e-13 ref|XP_020685666.1| gamma-interferon-inducible-lysosomal thiol r... 75 2e-13 ref|NP_001150878.2| uncharacterized protein LOC100284511 precurs... 75 2e-13 gb|ACG40758.1| gamma-interferon-inducible lysosomal thiol reduct... 75 2e-13 ref|NP_001151695.2| uncharacterized protein LOC100284511 precurs... 75 2e-13 >ref|XP_009400003.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Musa acuminata subsp. malaccensis] Length = 248 Score = 101 bits (252), Expect = 1e-23 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 1/77 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQ-RLLTISENKQLKTEESVCSVD 177 H+YVPW+VVNG+PLYEDYENFEHY+CKAYDGVPP+AC+ LL SE ++ EE C +D Sbjct: 171 HIYVPWLVVNGQPLYEDYENFEHYVCKAYDGVPPRACEGLLLRTSEKEKPNKEEPFCYID 230 Query: 178 WMAKYSSKGGKKQKLEL 228 + S GKK K+EL Sbjct: 231 GVIS-PSAAGKKHKMEL 246 >ref|XP_008777702.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Phoenix dactylifera] Length = 299 Score = 85.9 bits (211), Expect = 3e-17 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQ-RLLTISENKQLKTEESVCSVD 177 H YVPWVVV+GKPLY++Y NFE YIC+AYDG PPKAC+ + LTIS+ + VC VD Sbjct: 221 HTYVPWVVVDGKPLYDNYGNFEKYICQAYDGQPPKACEGQALTISQETNSNHGDQVCHVD 280 Query: 178 WMAKYSSKGGKKQKLELQN 234 M SS KK +++ +N Sbjct: 281 DMTG-SSATRKKHEMKKKN 298 >ref|XP_010922609.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X2 [Elaeis guineensis] Length = 245 Score = 84.0 bits (206), Expect = 7e-17 Identities = 41/76 (53%), Positives = 52/76 (68%), Gaps = 1/76 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQ-RLLTISENKQLKTEESVCSVD 177 H YVPWVVV+ KPLY+DY NFE YIC+AYDG PPKAC+ + LTIS+ + VC V+ Sbjct: 168 HTYVPWVVVDAKPLYDDYRNFEKYICQAYDGEPPKACEGQALTISQETNANQGDQVCHVN 227 Query: 178 WMAKYSSKGGKKQKLE 225 M SS KK +++ Sbjct: 228 DMTS-SSATRKKHEMK 242 >ref|XP_020108015.1| gamma-interferon-inducible lysosomal thiol reductase [Ananas comosus] Length = 259 Score = 83.2 bits (204), Expect = 2e-16 Identities = 39/77 (50%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEESVC-SVD 177 H YVPWVVV+G+PLYEDYENFE YICKAY GVPP AC+ LL + + +K + VC Sbjct: 183 HRYVPWVVVDGQPLYEDYENFESYICKAYKGVPPNACKELLKTTTD--IKASDRVCHRKK 240 Query: 178 WMAKYSSKGGKKQKLEL 228 ++ ++KG ++ K+++ Sbjct: 241 TISLSTTKGDEEMKIKM 257 >ref|XP_020252089.1| gamma-interferon-inducible lysosomal thiol reductase-like [Asparagus officinalis] gb|ONK77196.1| uncharacterized protein A4U43_C02F4080 [Asparagus officinalis] Length = 105 Score = 77.8 bits (190), Expect = 8e-16 Identities = 38/66 (57%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQR-LLTISENKQLKTEESVCSVD 177 H +VPWVVVNGKPLY+DY+NFE YICKAYDG PKAC+ LL I + K E C + Sbjct: 26 HEFVPWVVVNGKPLYDDYKNFEAYICKAYDGELPKACEGILLEIPQEKIGNKESQACRKN 85 Query: 178 WMAKYS 195 M + S Sbjct: 86 EMIRSS 91 >gb|PKA56182.1| hypothetical protein AXF42_Ash011111 [Apostasia shenzhenica] Length = 252 Score = 77.8 bits (190), Expect = 2e-14 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRL-LTISENKQLKTEESVCSVD 177 H YVPWVVVNGKPLY+DYENFE +CKAY G PPK C+RL +T ++ K+ V VD Sbjct: 180 HKYVPWVVVNGKPLYDDYENFEAEVCKAYVGEPPKTCKRLTVTTAKEKEAARAHHVSLVD 239 >ref|XP_021306003.1| gamma-interferon-inducible lysosomal thiol reductase-like isoform X2 [Sorghum bicolor] gb|KXG39572.1| hypothetical protein SORBI_3001G404500 [Sorghum bicolor] Length = 251 Score = 76.3 bits (186), Expect = 7e-14 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 3/77 (3%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQ---RLLTISENKQLKTEESVCS 171 H YVPWVVV+G+PL EDYENFE YICKAY G PPKAC+ RL + E + + S S Sbjct: 170 HRYVPWVVVDGQPLLEDYENFEAYICKAYKGTPPKACEGLGRLQMVLETAEARNGVSYNS 229 Query: 172 VDWMAKYSSKGGKKQKL 222 + GG+++K+ Sbjct: 230 GISKPATAEDGGRERKV 246 >ref|XP_019705948.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X1 [Elaeis guineensis] Length = 257 Score = 76.3 bits (186), Expect = 7e-14 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQ-RLLTISE 135 H YVPWVVV+ KPLY+DY NFE YIC+AYDG PPKAC+ + LTIS+ Sbjct: 168 HTYVPWVVVDAKPLYDDYRNFEKYICQAYDGEPPKACEGQALTISQ 213 >ref|XP_021305973.1| gamma-interferon-inducible lysosomal thiol reductase-like isoform X1 [Sorghum bicolor] gb|KXG39571.1| hypothetical protein SORBI_3001G404500 [Sorghum bicolor] Length = 262 Score = 76.3 bits (186), Expect = 8e-14 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 3/77 (3%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQ---RLLTISENKQLKTEESVCS 171 H YVPWVVV+G+PL EDYENFE YICKAY G PPKAC+ RL + E + + S S Sbjct: 181 HRYVPWVVVDGQPLLEDYENFEAYICKAYKGTPPKACEGLGRLQMVLETAEARNGVSYNS 240 Query: 172 VDWMAKYSSKGGKKQKL 222 + GG+++K+ Sbjct: 241 GISKPATAEDGGRERKV 257 >gb|EEC75043.1| hypothetical protein OsI_11143 [Oryza sativa Indica Group] Length = 256 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEESVCSVDW 180 H YVPWVVV+G+PLYEDYENFE YICKAY G PPK C+ L L+ E+V V + Sbjct: 170 HKYVPWVVVDGQPLYEDYENFEAYICKAYKGHPPKVCEGLARPPTPTVLEVAEAVNRVSY 229 >ref|XP_015631077.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X2 [Oryza sativa Japonica Group] gb|ABF95437.1| Gamma interferon inducible lysosomal thiol reductase family protein, expressed [Oryza sativa Japonica Group] dbj|BAG97530.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS83717.1| Os03g0295800 [Oryza sativa Japonica Group] Length = 256 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEESVCSVDW 180 H YVPWVVV+G+PLYEDYENFE YICKAY G PPK C+ L L+ E+V V + Sbjct: 170 HKYVPWVVVDGQPLYEDYENFEAYICKAYKGHPPKVCEGLARPPTPTVLEVAEAVNRVSY 229 >gb|EAZ26583.1| hypothetical protein OsJ_10480 [Oryza sativa Japonica Group] Length = 258 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEESVCSVDW 180 H YVPWVVV+G+PLYEDYENFE YICKAY G PPK C+ L L+ E+V V + Sbjct: 172 HKYVPWVVVDGQPLYEDYENFEAYICKAYKGHPPKVCEGLARPPTPTVLEVAEAVNRVSY 231 >ref|XP_015631076.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X1 [Oryza sativa Japonica Group] gb|ABF95436.1| Gamma interferon inducible lysosomal thiol reductase family protein, expressed [Oryza sativa Japonica Group] dbj|BAF11741.1| Os03g0295800 [Oryza sativa Japonica Group] dbj|BAG92595.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS83716.1| Os03g0295800 [Oryza sativa Japonica Group] Length = 265 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEESVCSVDW 180 H YVPWVVV+G+PLYEDYENFE YICKAY G PPK C+ L L+ E+V V + Sbjct: 179 HKYVPWVVVDGQPLYEDYENFEAYICKAYKGHPPKVCEGLARPPTPTVLEVAEAVNRVSY 238 >ref|XP_020271600.1| gamma-interferon-inducible lysosomal thiol reductase-like [Asparagus officinalis] ref|XP_020271601.1| gamma-interferon-inducible lysosomal thiol reductase-like [Asparagus officinalis] gb|ONK62663.1| uncharacterized protein A4U43_C07F6570 [Asparagus officinalis] Length = 191 Score = 74.3 bits (181), Expect = 1e-13 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEE 159 H YVPWVVVNG+PLYEDYEN + YICKAY+G P KAC+ L I+ + +E Sbjct: 118 HKYVPWVVVNGQPLYEDYENVQSYICKAYEGEPSKACEELPLITTPEAKANQE 170 >ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X1 [Elaeis guineensis] Length = 254 Score = 75.5 bits (184), Expect = 1e-13 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRLLTISENKQLKTEESVCSVD 177 H YVPWVVV+G+PLY+DY NFE YICKAYDG PK+C L++ + + KT+ C D Sbjct: 167 HTYVPWVVVDGQPLYDDYRNFEAYICKAYDGKLPKSCAG-LSLKLSSERKTDNQACYAD 224 >gb|PKU73518.1| hypothetical protein MA16_Dca008082 [Dendrobium catenatum] Length = 165 Score = 73.6 bits (179), Expect = 2e-13 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQR-LLTISENKQLKTEESVCSVD 177 H YVPWVVVNG PLY+DY+NFE YICK++ G P AC+R L I + + K+ + C ++ Sbjct: 95 HRYVPWVVVNGLPLYDDYDNFETYICKSFHGELPSACRRPSLKIPQQMKAKSPDRWCVMN 154 Query: 178 WMAKYSSKG 204 SSKG Sbjct: 155 DTTSSSSKG 163 >ref|XP_020685666.1| gamma-interferon-inducible-lysosomal thiol reductase-like [Dendrobium catenatum] gb|PKU73020.1| hypothetical protein MA16_Dca007583 [Dendrobium catenatum] Length = 241 Score = 75.1 bits (183), Expect = 2e-13 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDG-VPPKACQRLLTISENKQL 147 H YVPWVVVNG+PLYEDYENFE YIC AY+G PPKAC+ L ++ K++ Sbjct: 169 HKYVPWVVVNGQPLYEDYENFEAYICNAYEGNSPPKACEGLTGLATKKKV 218 >ref|NP_001150878.2| uncharacterized protein LOC100284511 precursor [Zea mays] gb|ACN29331.1| unknown [Zea mays] Length = 247 Score = 75.1 bits (183), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRL 120 H YVPWVVV+G+PL EDYENFE YICKAY G PPKACQ L Sbjct: 167 HRYVPWVVVDGQPLLEDYENFEAYICKAYKGTPPKACQGL 206 >gb|ACG40758.1| gamma-interferon-inducible lysosomal thiol reductase precursor [Zea mays] Length = 247 Score = 75.1 bits (183), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRL 120 H YVPWVVV+G+PL EDYENFE YICKAY G PPKACQ L Sbjct: 167 HRYVPWVVVDGQPLLEDYENFEAYICKAYKGTPPKACQGL 206 >ref|NP_001151695.2| uncharacterized protein LOC100284511 precursor [Zea mays] Length = 252 Score = 75.1 bits (183), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 1 HLYVPWVVVNGKPLYEDYENFEHYICKAYDGVPPKACQRL 120 H YVPWVVV+G+PL EDYENFE YICKAY G PPKACQ L Sbjct: 172 HRYVPWVVVDGQPLLEDYENFEAYICKAYKGTPPKACQGL 211