BLASTX nr result
ID: Cheilocostus21_contig00011754
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00011754 (1298 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009405584.1| PREDICTED: uncharacterized protein LOC103988... 71 9e-10 >ref|XP_009405584.1| PREDICTED: uncharacterized protein LOC103988698 [Musa acuminata subsp. malaccensis] Length = 382 Score = 71.2 bits (173), Expect = 9e-10 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -3 Query: 144 SQKQADELTPDSSVGMADSSKTVHVRFVLQKECAFGQQFFLVGDDPMF 1 + + D LT DS V AD KTVHVRFVLQKEC+FGQQF LVGDDPMF Sbjct: 69 ASSEVDRLTLDSYVEKADRYKTVHVRFVLQKECSFGQQFLLVGDDPMF 116