BLASTX nr result
ID: Cheilocostus21_contig00011619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00011619 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417529.1| PREDICTED: guanine nucleotide-binding protei... 67 3e-11 ref|XP_009413983.1| PREDICTED: guanine nucleotide-binding protei... 65 8e-11 gb|PKU63939.1| Guanine nucleotide-binding protein subunit gamma ... 54 6e-07 ref|XP_020689465.1| guanine nucleotide-binding protein subunit g... 54 2e-06 >ref|XP_009417529.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Musa acuminata subsp. malaccensis] Length = 115 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -2 Query: 464 TPGPENPAWHRWFQRVRSSQSRIWWMHKSSDDI 366 TPGPEN AWHRWFQRVRSS SR WW HK S DI Sbjct: 82 TPGPENAAWHRWFQRVRSSHSRKWWTHKGSSDI 114 >ref|XP_009413983.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Musa acuminata subsp. malaccensis] Length = 115 Score = 65.5 bits (158), Expect = 8e-11 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -2 Query: 464 TPGPENPAWHRWFQRVRSSQSRIWWMHKSSD 372 TPGPENPAWHRWFQRV SS SR WW HK SD Sbjct: 83 TPGPENPAWHRWFQRVPSSHSRKWWTHKGSD 113 >gb|PKU63939.1| Guanine nucleotide-binding protein subunit gamma 2 [Dendrobium catenatum] Length = 58 Score = 53.9 bits (128), Expect = 6e-07 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -2 Query: 464 TPGPENPAWHRWFQRVRSSQSRIWWMHKSSD 372 T GPEN AW RWF+ VRSS++R WW H+S+D Sbjct: 26 TTGPENSAWERWFRPVRSSRNRAWWAHRSAD 56 >ref|XP_020689465.1| guanine nucleotide-binding protein subunit gamma 2-like [Dendrobium catenatum] Length = 121 Score = 53.9 bits (128), Expect = 2e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -2 Query: 464 TPGPENPAWHRWFQRVRSSQSRIWWMHKSSD 372 T GPEN AW RWF+ VRSS++R WW H+S+D Sbjct: 89 TTGPENSAWERWFRPVRSSRNRAWWAHRSAD 119