BLASTX nr result
ID: Cheilocostus21_contig00010942
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010942 (754 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020533802.1| uncharacterized protein LOC105631043 [Jatrop... 57 5e-06 >ref|XP_020533802.1| uncharacterized protein LOC105631043 [Jatropha curcas] Length = 238 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/48 (64%), Positives = 32/48 (66%) Frame = +2 Query: 62 FVAYGSVSETAKLLGLSTGAXXXXXXXXXXXXMAVNELRTSKGLKPLK 205 F GSVSE AKLLGLSTGA MAVN+LRTSKGLKPLK Sbjct: 191 FAVEGSVSEAAKLLGLSTGALSRLLLSDDSLRMAVNDLRTSKGLKPLK 238