BLASTX nr result
ID: Cheilocostus21_contig00010700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010700 (719 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009396197.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_009408109.1| PREDICTED: pentatricopeptide repeat-containi... 68 5e-10 ref|XP_022764388.1| pentatricopeptide repeat-containing protein ... 67 2e-09 ref|XP_016670159.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_017647033.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_012470284.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 gb|PPS10370.1| hypothetical protein GOBAR_AA10272 [Gossypium bar... 67 3e-09 ref|NP_001314016.1| pentatricopeptide repeat-containing protein ... 67 3e-09 gb|KJB18787.1| hypothetical protein B456_003G069300 [Gossypium r... 67 4e-09 ref|XP_021892239.1| pentatricopeptide repeat-containing protein ... 66 4e-09 gb|OMO66877.1| hypothetical protein COLO4_30294 [Corchorus olito... 66 5e-09 gb|OMO86968.1| hypothetical protein CCACVL1_09362 [Corchorus cap... 65 7e-09 ref|XP_010941220.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|EOY23346.1| Pentatricopeptide repeat (PPR) superfamily protei... 64 2e-08 ref|XP_022736420.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_007038844.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_008799369.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_008799365.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_021297745.1| pentatricopeptide repeat-containing protein ... 64 4e-08 ref|XP_015571287.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 >ref|XP_009396197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Musa acuminata subsp. malaccensis] Length = 257 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQLNG 111 GMLDK+DKLK+KYPPPTWEYRY KGKRVR +V QL G Sbjct: 208 GMLDKYDKLKNKYPPPTWEYRYIKGKRVRIRVNQLQG 244 >ref|XP_009408109.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Musa acuminata subsp. malaccensis] Length = 249 Score = 68.2 bits (165), Expect = 5e-10 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQLNG 111 GMLDK+DKLKSKYPPPTWEYRY KGKRVR Q+ G Sbjct: 207 GMLDKYDKLKSKYPPPTWEYRYIKGKRVRIHANQIQG 243 >ref|XP_022764388.1| pentatricopeptide repeat-containing protein At4g21190-like [Durio zibethinus] Length = 274 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 210 GMLDKYDKLKKKYPPPKWEYRYIKGKRVKIQVKQL 244 >ref|XP_016670159.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190-like [Gossypium hirsutum] Length = 312 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLKKKYPPPKWEYRYIKGKRVKIQVKQL 242 >ref|XP_017647033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Gossypium arboreum] gb|KHG11943.1| Pentatricopeptide repeat-containing -like protein [Gossypium arboreum] Length = 312 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLKKKYPPPKWEYRYIKGKRVKIQVKQL 242 >ref|XP_012470284.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Gossypium raimondii] gb|KJB18786.1| hypothetical protein B456_003G069300 [Gossypium raimondii] Length = 306 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLKRKYPPPKWEYRYIKGKRVKIQVKQL 242 >gb|PPS10370.1| hypothetical protein GOBAR_AA10272 [Gossypium barbadense] Length = 312 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLKRKYPPPKWEYRYIKGKRVKIQVKQL 242 >ref|NP_001314016.1| pentatricopeptide repeat-containing protein At4g21190-like [Gossypium hirsutum] gb|ALK28529.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum] gb|PPD81679.1| hypothetical protein GOBAR_DD21387 [Gossypium barbadense] Length = 312 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLKRKYPPPKWEYRYIKGKRVKIQVKQL 242 >gb|KJB18787.1| hypothetical protein B456_003G069300 [Gossypium raimondii] Length = 330 Score = 66.6 bits (161), Expect = 4e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGKRV+ QVKQL Sbjct: 232 GMLDKYDKLKRKYPPPKWEYRYIKGKRVKIQVKQL 266 >ref|XP_021892239.1| pentatricopeptide repeat-containing protein At4g21190 [Carica papaya] Length = 284 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQLN 108 GMLDK+DKL KYPPP WEYRY KGKRVR Q KQLN Sbjct: 208 GMLDKYDKLVKKYPPPKWEYRYIKGKRVRIQAKQLN 243 >gb|OMO66877.1| hypothetical protein COLO4_30294 [Corchorus olitorius] Length = 284 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WE+RY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLKKKYPPPKWEFRYIKGKRVKVQVKQL 242 >gb|OMO86968.1| hypothetical protein CCACVL1_09362 [Corchorus capsularis] Length = 284 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKL KYPPP WEYRY KGKRV+ QVKQL Sbjct: 208 GMLDKYDKLNKKYPPPKWEYRYIKGKRVKVQVKQL 242 >ref|XP_010941220.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Elaeis guineensis] Length = 253 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQ 102 GMLDK+DKLK KYPPPTWEYRY KGKRVR +V + Sbjct: 208 GMLDKYDKLKKKYPPPTWEYRYIKGKRVRIRVNR 241 >gb|EOY23346.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 238 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKL KYPPP WEYRY KGKRV+ +VKQL Sbjct: 182 GMLDKYDKLNKKYPPPKWEYRYIKGKRVKIKVKQL 216 >ref|XP_022736420.1| pentatricopeptide repeat-containing protein At4g21190-like [Durio zibethinus] Length = 284 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKLK KYPPP WEYRY KGK V+ QVKQL Sbjct: 208 GMLDKYDKLKKKYPPPKWEYRYIKGKCVKIQVKQL 242 >ref|XP_007038844.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Theobroma cacao] gb|EOY23345.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 258 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKL KYPPP WEYRY KGKRV+ +VKQL Sbjct: 202 GMLDKYDKLNKKYPPPKWEYRYIKGKRVKIKVKQL 236 >ref|XP_008799369.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Phoenix dactylifera] ref|XP_008799370.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Phoenix dactylifera] ref|XP_008799371.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Phoenix dactylifera] Length = 235 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQ 102 GMLDK+DKLK KYPPP WEYRY KGKRVR +V Q Sbjct: 187 GMLDKYDKLKKKYPPPRWEYRYIKGKRVRIRVNQ 220 >ref|XP_008799365.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X1 [Phoenix dactylifera] ref|XP_008799366.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X1 [Phoenix dactylifera] ref|XP_008799368.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X1 [Phoenix dactylifera] ref|XP_017699961.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X1 [Phoenix dactylifera] Length = 256 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQ 102 GMLDK+DKLK KYPPP WEYRY KGKRVR +V Q Sbjct: 208 GMLDKYDKLKKKYPPPRWEYRYIKGKRVRIRVNQ 241 >ref|XP_021297745.1| pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Herrania umbratica] Length = 323 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQL 105 GMLDK+DKL KYPPP WEYRY KGKRV+ +VKQL Sbjct: 267 GMLDKYDKLNKKYPPPKWEYRYIKGKRVKIKVKQL 301 >ref|XP_015571287.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Ricinus communis] Length = 326 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 GMLDKFDKLKSKYPPPTWEYRYYKGKRVRKQVKQLN 108 GMLDK+ KLK KYPPP WEYRY KGKRVR + KQ+N Sbjct: 208 GMLDKYRKLKKKYPPPKWEYRYIKGKRVRLRAKQVN 243