BLASTX nr result
ID: Cheilocostus21_contig00010586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010586 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58010.1| uncharacterized protein A4U43_C09F6910 [Asparagus... 53 2e-06 >gb|ONK58010.1| uncharacterized protein A4U43_C09F6910 [Asparagus officinalis] Length = 77 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 429 KRGEKTKPAARWRHGSTTFFVAVDYLFLLIFFCFLGYLL 313 K+G++ P RHGST FFV VDYLFL IFFCFL YLL Sbjct: 9 KKGQRN-PNPNRRHGSTKFFVMVDYLFLFIFFCFLCYLL 46