BLASTX nr result
ID: Cheilocostus21_contig00010585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010585 (609 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58010.1| uncharacterized protein A4U43_C09F6910 [Asparagus... 56 3e-07 gb|PIM99370.1| hypothetical protein CDL12_28137 [Handroanthus im... 52 5e-06 >gb|ONK58010.1| uncharacterized protein A4U43_C09F6910 [Asparagus officinalis] Length = 77 Score = 56.2 bits (134), Expect = 3e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -2 Query: 533 KRGEKTKPAAKRRHGSTTFFVAVDYLFLLIFFCFLGYLL 417 K+G++ P RRHGST FFV VDYLFL IFFCFL YLL Sbjct: 9 KKGQRN-PNPNRRHGSTKFFVMVDYLFLFIFFCFLCYLL 46 >gb|PIM99370.1| hypothetical protein CDL12_28137 [Handroanthus impetiginosus] Length = 59 Score = 52.4 bits (124), Expect = 5e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -2 Query: 533 KRGEKTKPAAKRRHGSTTFFVAVDYLFLLIFFCFLGYLLSQI 408 K+ K K K+ HGS FFV +DYLFL IFFCFLG++L ++ Sbjct: 15 KQQTKKKTTIKKNHGSPPFFVFIDYLFLGIFFCFLGFILFKL 56