BLASTX nr result
ID: Cheilocostus21_contig00010301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010301 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381561.1| PREDICTED: vegetative cell wall protein gp1-... 55 6e-06 >ref|XP_009381561.1| PREDICTED: vegetative cell wall protein gp1-like [Musa acuminata subsp. malaccensis] Length = 213 Score = 55.1 bits (131), Expect = 6e-06 Identities = 40/80 (50%), Positives = 47/80 (58%), Gaps = 6/80 (7%) Frame = -3 Query: 381 GTVSEGDGRSGRVLEMGQVRILKRGEELK----RATSVITPHLVSVGFSPNRLDTEPLIS 214 G +SEG+ RS R L M VRILKRGEELK RA ++ SV S NRL EP I Sbjct: 99 GALSEGETRSRRALVMEGVRILKRGEELKPGAPRAADLVREGDGSVFCSTNRLGPEPEIL 158 Query: 213 PPK--MLGLQRPKAYAGPAY 160 P K + L+ P YAGPA+ Sbjct: 159 PRKGGLAVLESP--YAGPAF 176