BLASTX nr result
ID: Cheilocostus21_contig00010264
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010264 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009419741.1| PREDICTED: L-type lectin-domain containing r... 71 2e-11 ref|XP_009412582.1| PREDICTED: L-type lectin-domain containing r... 64 4e-09 ref|XP_009407575.1| PREDICTED: L-type lectin-domain containing r... 56 4e-06 >ref|XP_009419741.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like [Musa acuminata subsp. malaccensis] Length = 350 Score = 71.2 bits (173), Expect = 2e-11 Identities = 40/80 (50%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = -3 Query: 238 RIFAVAMSAPASTFXXXXXXXXXAPIPSKSREEACG-GNDFCFSLDVSGKNRSFGSDFAA 62 RIF +AMS P+STF S R E NDFCFS D S KNRSF S+F Sbjct: 5 RIFVMAMSPPSSTFTVVVVVLLFGVFLSGGRCEVRNKANDFCFSFDGSEKNRSFDSEFTL 64 Query: 61 FGDAELGSSTVRITRPGSSS 2 +GDA++ S VRITRP +SS Sbjct: 65 YGDAQMSGSAVRITRPANSS 84 >ref|XP_009412582.1| PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like [Musa acuminata subsp. malaccensis] Length = 346 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/73 (46%), Positives = 42/73 (57%) Frame = -3 Query: 220 MSAPASTFXXXXXXXXXAPIPSKSREEACGGNDFCFSLDVSGKNRSFGSDFAAFGDAELG 41 M +PASTF + ++ E A +DFCFS D KNRSF SDFA +GDAE+ Sbjct: 1 MPSPASTFVVVVVFLFVVSLSDRNCEAADKDHDFCFSFDGLEKNRSFDSDFALYGDAEMS 60 Query: 40 SSTVRITRPGSSS 2 S VRI +P SS Sbjct: 61 GSAVRIAQPAYSS 73 >ref|XP_009407575.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.4-like [Musa acuminata subsp. malaccensis] Length = 345 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 124 DFCFSLDVSGKNRSFGSDFAAFGDAEL-GSSTVRITRPGSSS 2 DFCFS D KNRSF S+F FGDAE+ GSS VRITRP +SS Sbjct: 30 DFCFSFDGFEKNRSFESEFELFGDAEVSGSSAVRITRPANSS 71