BLASTX nr result
ID: Cheilocostus21_contig00010260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010260 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009421366.1| PREDICTED: probable protein phosphatase 2C 6... 61 4e-08 ref|XP_009404640.1| PREDICTED: probable protein phosphatase 2C 3... 58 5e-07 ref|XP_020086989.1| probable protein phosphatase 2C 38 [Ananas c... 55 5e-06 >ref|XP_009421366.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata subsp. malaccensis] Length = 380 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = +3 Query: 300 IVALMKILSSCWKPATET---RDGGSVARADRLLWYKDLGRH 416 +VALMKI+ CWKPA E R GGS ARAD LLWYKDLGRH Sbjct: 1 MVALMKIVRPCWKPAPEEGRGRGGGSPARADGLLWYKDLGRH 42 >ref|XP_009404640.1| PREDICTED: probable protein phosphatase 2C 38 [Musa acuminata subsp. malaccensis] Length = 379 Score = 57.8 bits (138), Expect = 5e-07 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 306 ALMKILSSCWKPATET--RDGGSVARADRLLWYKDLGRH 416 ALMKI+S CWKP R GGS ARAD LLWYKDLGRH Sbjct: 6 ALMKIVSPCWKPVDGRGGRHGGSAARADGLLWYKDLGRH 44 >ref|XP_020086989.1| probable protein phosphatase 2C 38 [Ananas comosus] ref|XP_020086991.1| probable protein phosphatase 2C 38 [Ananas comosus] gb|OAY62743.1| putative protein phosphatase 2C 38 [Ananas comosus] Length = 386 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +3 Query: 306 ALMKILSSCWKPATE--TRDGGSVARADRLLWYKDLGRH 416 ALMKI+S CWKP+ E + GG RAD LLWYKDLGRH Sbjct: 6 ALMKIVSPCWKPSPEADSGSGGGGGRADGLLWYKDLGRH 44