BLASTX nr result
ID: Cheilocostus21_contig00010047
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00010047 (548 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009421318.1| PREDICTED: leucine-rich repeat extensin-like... 61 1e-07 >ref|XP_009421318.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Musa acuminata subsp. malaccensis] Length = 358 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/62 (51%), Positives = 36/62 (58%) Frame = -1 Query: 545 PSAPMGYSSGFSPYEHKPKGGRXXXXXXXXXXXXXXXXXXXXXXXXLKYEEEKIAEKVES 366 PSAP GYSSG+S Y+HKPKGGR LKYEEEKIAE+VES Sbjct: 284 PSAPTGYSSGYSAYDHKPKGGRMGAATGLAVGAVAGALGGLALEEGLKYEEEKIAERVES 343 Query: 365 DL 360 D+ Sbjct: 344 DV 345