BLASTX nr result
ID: Cheilocostus21_contig00009999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00009999 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399205.1| PREDICTED: probable galacturonosyltransferas... 56 3e-06 ref|XP_009405288.1| PREDICTED: probable galacturonosyltransferas... 55 7e-06 >ref|XP_009399205.1| PREDICTED: probable galacturonosyltransferase 10 [Musa acuminata subsp. malaccensis] Length = 535 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 130 SREKLPISAPPSIRKNLERPSINEGLNVTDDKLSPYSLMRQM 5 SREKLP S PPSIR+ L+ S+ E LN+TD+ LSPYS RQ+ Sbjct: 39 SREKLPRSVPPSIRQKLDHSSVIEDLNITDEMLSPYSFTRQI 80 >ref|XP_009405288.1| PREDICTED: probable galacturonosyltransferase 10 [Musa acuminata subsp. malaccensis] Length = 535 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -3 Query: 130 SREKLPISAPPSIRKNLERPSINEGLNVTDDKLSPYSLMRQM 5 SREKLP S PP +R+ L R S EGLN+TD+ LSPYS RQ+ Sbjct: 39 SREKLPRSDPPLVRQKLYRSSFPEGLNITDEMLSPYSFTRQI 80