BLASTX nr result
ID: Cheilocostus21_contig00009983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00009983 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009380973.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 87 4e-17 ref|XP_019708653.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 86 7e-17 ref|XP_015622133.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 86 7e-17 ref|XP_010931551.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 86 8e-17 ref|XP_002523216.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 86 9e-17 ref|XP_020268274.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol k... 86 1e-16 gb|OEL32383.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 86 1e-16 ref|XP_010922252.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 84 1e-16 gb|ONI14214.1| hypothetical protein PRUPE_4G269400 [Prunus persica] 85 2e-16 ref|XP_007212350.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol k... 85 2e-16 gb|EAY76173.1| hypothetical protein OsI_04105 [Oryza sativa Indi... 85 2e-16 ref|XP_004970280.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol k... 85 2e-16 ref|XP_020113531.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol k... 85 2e-16 ref|XP_015899624.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 85 2e-16 gb|OAY84906.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 85 2e-16 ref|XP_015899623.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 85 2e-16 ref|XP_004144086.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 85 2e-16 ref|XP_004291722.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 84 3e-16 ref|XP_004291721.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 84 3e-16 ref|XP_021664583.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol k... 84 3e-16 >ref|XP_009380973.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Musa acuminata subsp. malaccensis] Length = 405 Score = 87.0 bits (214), Expect = 4e-17 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLKKRVLAASRG Y+AV MSGSGSTIVG Sbjct: 302 DVCINDLEPPAFEVLPSLKRLKKRVLAASRGQYDAVFMSGSGSTIVG 348 >ref|XP_019708653.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic-like isoform X1 [Elaeis guineensis] Length = 401 Score = 86.3 bits (212), Expect = 7e-17 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLK+LKKRVLAA RG YNAV MSGSGSTIVG Sbjct: 294 DVCINDLEPPAFEVLPSLKKLKKRVLAAGRGEYNAVFMSGSGSTIVG 340 >ref|XP_015622133.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Oryza sativa Japonica Group] sp|Q8S2G0.1|ISPE_ORYSJ RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic; AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase; Short=CDPMEK; Short=CMEK; Flags: Precursor dbj|BAB86428.1| putative isopentenyl monophosphate kinase [Oryza sativa Japonica Group] dbj|BAF06458.1| Os01g0802100 [Oryza sativa Japonica Group] gb|EAZ11943.1| hypothetical protein OsJ_01815 [Oryza sativa Japonica Group] dbj|BAG90487.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS74806.1| Os01g0802100 [Oryza sativa Japonica Group] Length = 401 Score = 86.3 bits (212), Expect = 7e-17 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 DAC+NDLEPPAFEVLPSLKRLKKR++AA+RG Y+AV MSGSGSTIVG Sbjct: 297 DACVNDLEPPAFEVLPSLKRLKKRIIAANRGDYDAVFMSGSGSTIVG 343 >ref|XP_010931551.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic-like isoform X2 [Elaeis guineensis] Length = 428 Score = 86.3 bits (212), Expect = 8e-17 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLK+LKKRVLAA RG YNAV MSGSGSTIVG Sbjct: 294 DVCINDLEPPAFEVLPSLKKLKKRVLAAGRGEYNAVFMSGSGSTIVG 340 >ref|XP_002523216.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Ricinus communis] ref|XP_015577299.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Ricinus communis] gb|EEF39137.1| 4-diphosphocytidyl-2-C-methyl-d-erythritol kinase, putative [Ricinus communis] Length = 388 Score = 85.9 bits (211), Expect = 9e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+R++AASRG YNAV MSGSGSTIVG Sbjct: 287 DVCINDLEPPAFEVLPSLKRLKQRIVAASRGQYNAVFMSGSGSTIVG 333 >ref|XP_020268274.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Asparagus officinalis] gb|ONK67482.1| uncharacterized protein A4U43_C05F510 [Asparagus officinalis] Length = 398 Score = 85.9 bits (211), Expect = 1e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D C+NDLEPPAFEV+PSLKRLK+RVLAASRG YNAV MSGSGSTIVG Sbjct: 297 DVCVNDLEPPAFEVVPSLKRLKQRVLAASRGEYNAVFMSGSGSTIVG 343 >gb|OEL32383.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Dichanthelium oligosanthes] Length = 405 Score = 85.5 bits (210), Expect = 1e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D C+NDLEPPAFEVLPSLKRLKKR++AASR YNAV MSGSGSTIVG Sbjct: 303 DVCVNDLEPPAFEVLPSLKRLKKRIIAASRDNYNAVFMSGSGSTIVG 349 >ref|XP_010922252.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Elaeis guineensis] Length = 397 Score = 84.3 bits (207), Expect(2) = 1e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLK+LKKRVLAA RG Y+AV MSGSGSTIVG Sbjct: 294 DVCINDLEPPAFEVLPSLKKLKKRVLAAGRGEYSAVFMSGSGSTIVG 340 Score = 29.3 bits (64), Expect(2) = 1e-16 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 259 YREPSTSTAYFSKDMASGVGS 197 Y PS+STA FS+D++SGV S Sbjct: 375 YTAPSSSTASFSRDLSSGVVS 395 >gb|ONI14214.1| hypothetical protein PRUPE_4G269400 [Prunus persica] Length = 372 Score = 85.1 bits (209), Expect = 2e-16 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+RVLAASRG Y AV MSGSGSTIVG Sbjct: 271 DVCINDLEPPAFEVLPSLKRLKQRVLAASRGQYGAVFMSGSGSTIVG 317 >ref|XP_007212350.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Prunus persica] gb|ONI14215.1| hypothetical protein PRUPE_4G269400 [Prunus persica] Length = 395 Score = 85.1 bits (209), Expect = 2e-16 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+RVLAASRG Y AV MSGSGSTIVG Sbjct: 294 DVCINDLEPPAFEVLPSLKRLKQRVLAASRGQYGAVFMSGSGSTIVG 340 >gb|EAY76173.1| hypothetical protein OsI_04105 [Oryza sativa Indica Group] Length = 401 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 DAC+NDLEPPAF+VLPSLKRLKKR++AA+RG Y+AV MSGSGSTIVG Sbjct: 297 DACVNDLEPPAFDVLPSLKRLKKRIIAANRGDYDAVFMSGSGSTIVG 343 >ref|XP_004970280.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Setaria italica] gb|KQL07364.1| hypothetical protein SETIT_001697mg [Setaria italica] Length = 404 Score = 85.1 bits (209), Expect = 2e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D C+NDLEPPAFEVLPSLKRLKKR++AASR YNAV MSGSGSTIVG Sbjct: 302 DVCVNDLEPPAFEVLPSLKRLKKRIIAASRDDYNAVFMSGSGSTIVG 348 >ref|XP_020113531.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Ananas comosus] Length = 405 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D C+NDLEPPAFEVLPSLK+LKKR++AA RG YNAV MSGSGSTIVG Sbjct: 301 DVCVNDLEPPAFEVLPSLKKLKKRIIAAGRGDYNAVFMSGSGSTIVG 347 >ref|XP_015899624.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic isoform X2 [Ziziphus jujuba] Length = 359 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+RV+AASRG Y+AV MSGSGSTIVG Sbjct: 258 DVCINDLEPPAFEVLPSLKRLKQRVIAASRGQYDAVFMSGSGSTIVG 304 >gb|OAY84906.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Ananas comosus] Length = 411 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D C+NDLEPPAFEVLPSLK+LKKR++AA RG YNAV MSGSGSTIVG Sbjct: 307 DVCVNDLEPPAFEVLPSLKKLKKRIIAAGRGDYNAVFMSGSGSTIVG 353 >ref|XP_015899623.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic isoform X1 [Ziziphus jujuba] Length = 394 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+RV+AASRG Y+AV MSGSGSTIVG Sbjct: 293 DVCINDLEPPAFEVLPSLKRLKQRVIAASRGQYDAVFMSGSGSTIVG 339 >ref|XP_004144086.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic [Cucumis sativus] gb|KGN66389.1| hypothetical protein Csa_1G600780 [Cucumis sativus] Length = 394 Score = 84.7 bits (208), Expect = 2e-16 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+R+++ASRGG++AV MSGSGSTIVG Sbjct: 291 DVCINDLEPPAFEVLPSLKRLKQRIISASRGGFDAVFMSGSGSTIVG 337 >ref|XP_004291722.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic isoform X2 [Fragaria vesca subsp. vesca] Length = 365 Score = 84.3 bits (207), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAF+VLPSLKRLK+RVLAASRG Y+AV MSGSGSTIVG Sbjct: 264 DVCINDLEPPAFQVLPSLKRLKQRVLAASRGQYDAVFMSGSGSTIVG 310 >ref|XP_004291721.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic isoform X1 [Fragaria vesca subsp. vesca] Length = 370 Score = 84.3 bits (207), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAF+VLPSLKRLK+RVLAASRG Y+AV MSGSGSTIVG Sbjct: 264 DVCINDLEPPAFQVLPSLKRLKQRVLAASRGQYDAVFMSGSGSTIVG 310 >ref|XP_021664583.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic-like isoform X1 [Hevea brasiliensis] Length = 388 Score = 84.3 bits (207), Expect = 3e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -1 Query: 459 DACINDLEPPAFEVLPSLKRLKKRVLAASRGGYNAVLMSGSGSTIVG 319 D CINDLEPPAFEVLPSLKRLK+R++AASRG Y+AV MSGSGSTIVG Sbjct: 287 DVCINDLEPPAFEVLPSLKRLKQRIIAASRGQYDAVFMSGSGSTIVG 333